Sequence 1: | NP_001137671.1 | Gene: | CG42391 / 7354405 | FlyBaseID: | FBgn0259737 | Length: | 253 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005253062.1 | Gene: | PIDD1 / 55367 | HGNCID: | 16491 | Length: | 934 | Species: | Homo sapiens |
Alignment Length: | 200 | Identity: | 43/200 - (21%) |
---|---|---|---|
Similarity: | 63/200 - (31%) | Gaps: | 66/200 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 74 WYRDNDCI-----------NRHYFNYILL----DPR--------------VTNNLKERASQLHLM 109
Fly 110 DVWYTFLRAIFYVG--KG---KATRP-----------YVHLKNAQKLVDETNNITLVKDPKLALI 158
Fly 159 ---VSIWKANRGVLLIRAFQGISSQDAQTREASIIDALGMNHLTNRRLGFYYGRARSLSDKERKY 220
Fly 221 LGIAL 225 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42391 | NP_001137671.1 | Peptidase_S80 | <37..>101 | CDD:305105 | 10/55 (18%) |
GIY-YIG_COG3680_Meta | 85..200 | CDD:198401 | 32/151 (21%) | ||
PIDD1 | XP_005253062.1 | leucine-rich repeat | 39..63 | CDD:275380 | |
leucine-rich repeat | 64..91 | CDD:275380 | |||
LRR_RI | <117..>279 | CDD:238064 | |||
LRR_8 | 126..183 | CDD:290566 | |||
leucine-rich repeat | 127..152 | CDD:275380 | |||
leucine-rich repeat | 153..172 | CDD:275380 | |||
leucine-rich repeat | 173..195 | CDD:275380 | |||
LRR_8 | 194..252 | CDD:290566 | |||
leucine-rich repeat | 196..218 | CDD:275380 | |||
leucine-rich repeat | 219..241 | CDD:275380 | |||
LRR_8 | 240..295 | CDD:290566 | |||
leucine-rich repeat | 242..264 | CDD:275380 | |||
leucine-rich repeat | 265..286 | CDD:275380 | |||
ZU5 | 325..398 | CDD:295340 | |||
Peptidase_S68 | 421..453 | CDD:287439 | |||
ZU5 | 465..537 | CDD:295340 | |||
Death_PIDD | 812..897 | CDD:260049 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG4177 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |