DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and PIDD1

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_005253062.1 Gene:PIDD1 / 55367 HGNCID:16491 Length:934 Species:Homo sapiens


Alignment Length:200 Identity:43/200 - (21%)
Similarity:63/200 - (31%) Gaps:66/200 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 WYRDNDCI-----------NRHYFNYILL----DPR--------------VTNNLKERASQLHLM 109
            ||...:|:           ..|..|.|.|    ||.              ....|.||.......
Human   617 WYTTKNCVGGLARKAWERLRLHRVNLIALQRRRDPEQVLLQCLPRNKVDATLRRLLERYRGPEPS 681

  Fly   110 DVWYTFLRAIFYVG--KG---KATRP-----------YVHLKNAQKLVDETNNITLVKDPKLALI 158
            |....|....|:..  :|   .|.||           |.||||.:::.     :|...|.:...:
Human   682 DTVEMFEGEEFFAAFERGIDVDADRPDCVEGRICFVFYSHLKNVKEVY-----VTTTLDREAQAV 741

  Fly   159 ---VSIWKANRGVLLIRAFQGISSQDAQTREASIIDALGMNHLTNRRLGFYYGRARSLSDKERKY 220
               ||.:   ||.:.:|    :..:....|:....|||.|     ..|.....|.|. |:..|:.
Human   742 RGQVSFY---RGAVPVR----VPEEAEAARQRKGADALWM-----ATLPIKLPRLRG-SEGPRRG 793

  Fly   221 LGIAL 225
            .|::|
Human   794 AGLSL 798

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105 10/55 (18%)
GIY-YIG_COG3680_Meta 85..200 CDD:198401 32/151 (21%)
PIDD1XP_005253062.1 leucine-rich repeat 39..63 CDD:275380
leucine-rich repeat 64..91 CDD:275380
LRR_RI <117..>279 CDD:238064
LRR_8 126..183 CDD:290566
leucine-rich repeat 127..152 CDD:275380
leucine-rich repeat 153..172 CDD:275380
leucine-rich repeat 173..195 CDD:275380
LRR_8 194..252 CDD:290566
leucine-rich repeat 196..218 CDD:275380
leucine-rich repeat 219..241 CDD:275380
LRR_8 240..295 CDD:290566
leucine-rich repeat 242..264 CDD:275380
leucine-rich repeat 265..286 CDD:275380
ZU5 325..398 CDD:295340
Peptidase_S68 421..453 CDD:287439
ZU5 465..537 CDD:295340
Death_PIDD 812..897 CDD:260049
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.