DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and Ankrd7

DIOPT Version :10

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001178941.1 Gene:Ankrd7 / 502733 RGDID:1564660 Length:279 Species:Rattus norvegicus


Alignment Length:141 Identity:32/141 - (22%)
Similarity:54/141 - (38%) Gaps:39/141 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 GKGKATRPYVHLKNAQKLVDETNNITLVKDPKLALIVSIWKANRGVLLIRAFQGISSQDAQTREA 187
            |:.|.:|..:|...|.   ..||.::|:.:.:..:.|.. ..||..|:        .|.|:.::.
  Rat    75 GRDKRSRTPLHFACAN---GYTNIVSLLIENQCKINVQD-SENRTPLI--------KQAAECQQE 127

  Fly   188 SIIDALGMNHLTNRRLGFYYGRAR----------SLSDKERKY----------------LGIALL 226
            |....| ::|..:..||..||...          ||::|...|                |.:|..
  Rat   128 SCATLL-LHHGADPNLGDIYGNTALHYAVYGQNISLANKLLDYKANLEAKNKDGYTPLLLAVAEN 191

  Fly   227 YKLMMKFLAKE 237
            .:.|:|||.|:
  Rat   192 NENMVKFLLKK 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 GIY-YIG_COG3680_Meta 85..200 CDD:198401 17/76 (22%)
Ankrd7NP_001178941.1 ANKYR 41..257 CDD:440430 32/141 (23%)
ANK repeat 50..77 CDD:293786 1/1 (100%)
ANK repeat 79..110 CDD:293786 7/33 (21%)
ANK repeat 112..144 CDD:293786 9/40 (23%)
ANK repeat 146..177 CDD:293786 6/30 (20%)
ANK repeat 179..210 CDD:293786 7/24 (29%)
ANK repeat 212..243 CDD:293786
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.