DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42391 and Ankrd7

DIOPT Version :9

Sequence 1:	NP_001137671.1	Gene:	CG42391 / 7354405	FlyBaseID:	FBgn0259737	Length:	253	Species:	Drosophila melanogaster
Sequence 2:	NP_001178941.1	Gene:	Ankrd7 / 502733	RGDID:	1564660	Length:	279	Species:	Rattus norvegicus

Alignment Length:	141	Identity:	32/141 - (22%)
Similarity:	54/141 - (38%)	Gaps:	39/141 - (27%)

- Green bases have known domain annotations that are detailed below.

  Fly   123 GKGKATRPYVHLKNAQKLVDETNNITLVKDPKLALIVSIWKANRGVLLIRAFQGISSQDAQTREA 187
            |:.|.:|..:|...|.   ..||.::|:.:.:..:.|.. ..||..|:        .|.|:.::.
  Rat    75 GRDKRSRTPLHFACAN---GYTNIVSLLIENQCKINVQD-SENRTPLI--------KQAAECQQE 127

  Fly   188 SIIDALGMNHLTNRRLGFYYGRAR----------SLSDKERKY----------------LGIALL 226
            |....| ::|..:..||..||...          ||::|...|                |.:|..
  Rat   128 SCATLL-LHHGADPNLGDIYGNTALHYAVYGQNISLANKLLDYKANLEAKNKDGYTPLLLAVAEN 191

  Fly   227 YKLMMKFLAKE 237
            .:.|:|||.|:
  Rat   192 NENMVKFLLKK 202

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42391	NP_001137671.1	Peptidase_S80	<37..>101	CDD:305105
CG42391	NP_001137671.1	GIY-YIG_COG3680_Meta	85..200	CDD:198401	17/76 (22%)
Ankrd7	NP_001178941.1	Ank_2	50..144	CDD:289560	18/81 (22%)
		ANK repeat	50..77	CDD:293786	1/1 (100%)
		ANK	74..200	CDD:238125	30/137 (22%)
		ANK repeat	79..110	CDD:293786	7/33 (21%)
		ANK repeat	112..144	CDD:293786	9/40 (23%)
		Ank_2	120..210	CDD:289560	20/84 (24%)
		ANK	141..265	CDD:238125	15/62 (24%)
		ANK repeat	146..177	CDD:293786	6/30 (20%)
		ANK repeat	179..210	CDD:293786	7/24 (29%)
		Ank_5	199..253	CDD:290568	2/4 (50%)
		ANK repeat	212..243	CDD:293786
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C166345574
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930