DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and zgc:85936

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_999909.1 Gene:zgc:85936 / 406563 ZFINID:ZDB-GENE-040426-2450 Length:927 Species:Danio rerio


Alignment Length:248 Identity:81/248 - (32%)
Similarity:129/248 - (52%) Gaps:37/248 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TIPLQLRNNFKSKVKARPISYSLGTLHKHHTNFSTELENTINS----ESNFKNISNLIKFVR--Q 70
            |.||.|:       |.|.:..:....|.....:|.||.:.::.    :.....:|...:|.:  |
Zfish   697 TRPLYLQ-------KLRRVLQTSDPAHACGAGYSPELAHALDGFVLPDCLADELSLCEQFDKPDQ 754

  Fly    71 HSKWYRDNDCINRHYFNYILLDPRVTNNLKERASQLHLMDVWYTFLRAIFYVGKGKATRPYVHL- 134
            :.:|   .:...:..|||:|||||||.||..|:..:...:.:.||:.|:|||||||.:|||.|| 
Zfish   755 NRRW---REGFIKSSFNYLLLDPRVTRNLPYRSQAMAPQECFQTFISAVFYVGKGKRSRPYSHLY 816

  Fly   135 ---------KNAQKLVDETNNITLVKDPKLALIVSIWKANRGVLLIRAFQGISSQDAQTREASII 190
                     |.::||..           |:..|:.:|:|..||:.:..||.:.:.:|.||||.::
Zfish   817 EALEYYSGDKTSKKLCS-----------KVQQILQVWRAGHGVISLHCFQNVMAVEAYTREACMV 870

  Fly   191 DALGMNHLTNRRLGFYYGRARSLSDKERKYLGIALLYKLMMKFLAKEEKELFP 243
            ||:|:..|||::.|.|||...:...:.|:.||:.|||:.|..|||:.|::|.|
Zfish   871 DAIGLKMLTNQKKGDYYGIVSTWPAQRRRNLGVHLLYRAMQIFLAEGERQLRP 923

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105 20/69 (29%)
GIY-YIG_COG3680_Meta 85..200 CDD:198401 48/124 (39%)
zgc:85936NP_999909.1 ANK 10..124 CDD:238125
ANK repeat 10..36 CDD:293786
Ank_5 25..82 CDD:290568
ANK repeat 38..72 CDD:293786
ANK repeat 74..105 CDD:293786
LEM 674..710 CDD:240585 6/19 (32%)
GIY-YIG_COG3680_Meta 766..880 CDD:198401 48/124 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1451150at2759
OrthoFinder 1 1.000 - - FOG0005201
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3306
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.