powered by:
Protein Alignment CG42391 and si:ch211-272n13.3
DIOPT Version :10
| Sequence 1: | NP_001137671.1 |
Gene: | CG42391 / 7354405 |
FlyBaseID: | FBgn0259737 |
Length: | 253 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_068073574.2 |
Gene: | si:ch211-272n13.3 / 402845 |
ZFINID: | ZDB-GENE-081104-216 |
Length: | 2890 |
Species: | Danio rerio |
| Alignment Length: | 69 |
Identity: | 18/69 - (26%) |
| Similarity: | 22/69 - (31%) |
Gaps: | 27/69 - (39%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 10 IQTIPLQLRNNFKSKVKARPISYSLGTLHKHHTNFSTELENTINSESNFKNISNLIKFVRQHSKW 74
:.|.||....:..| |.|| |....||:||.|..| :.|.|
Zfish 1248 LNTAPLPSPRSLNS--KPRP------------------LPRLRNSDSNHKPES-------EESDW 1285
Fly 75 YRDN 78
..||
Zfish 1286 DTDN 1289
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG42391 | NP_001137671.1 |
GIY-YIG_COG3680_Meta |
85..200 |
CDD:198401 |
|
| si:ch211-272n13.3 | XP_068073574.2 |
None |
|
Blue background indicates that the domain is not in
the aligned region.
|
Return to query results.
Submit another query.
