DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and Ank2

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001189070.1 Gene:Ank2 / 38863 FlyBaseID:FBgn0261788 Length:13559 Species:Drosophila melanogaster


Alignment Length:156 Identity:38/156 - (24%)
Similarity:59/156 - (37%) Gaps:24/156 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QTIPLQLRNNFKSKVKARP-ISYSLGTLHKHHTNFSTELENTINSESNFKNISNLIKFVRQHSKW 74
            |..|::  .|..:|:...| |:::|..||........:.:..::..|.||  |.|.|.|  |...
  Fly  2869 QEFPIE--TNLDTKLVEFPKITHTLERLHSISKTDIADTKKVVHESSEFK--SKLDKLV--HKTE 2927

  Fly    75 YRDNDCINRHYFNYILLDPRVTNNLKERASQLHLMDVWYTFLRAIFY----VGKGKATRPYVHLK 135
            ..||.  |...|.:...|     |..|..:|..|.....|...:..|    .||....:..:..:
  Fly  2928 QTDNQ--NPDKFKFPTQD-----NFDELQTQKSLTSELVTMTDSSEYKFPPEGKSILGKEPIESE 2985

  Fly   136 NAQKLVDETNNITLVKDPKLALIVSI 161
            :.::| |..|.|.     ||.|:..|
  Fly  2986 SDEEL-DNLNKIC-----KLQLLSKI 3005

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105 16/63 (25%)
GIY-YIG_COG3680_Meta 85..200 CDD:198401 18/81 (22%)
Ank2NP_001189070.1 ANK repeat 10..41 CDD:293786
Ank_4 11..64 CDD:290365
ANK 38..163 CDD:238125
ANK repeat 43..74 CDD:293786
Ank_2 48..135 CDD:289560
ANK repeat 76..107 CDD:293786
ANK repeat 109..134 CDD:293786
Ank_4 110..163 CDD:290365
Ank_4 172..225 CDD:290365
ANK repeat 175..202 CDD:293786
ANK 199..324 CDD:238125
ANK repeat 204..235 CDD:293786
Ank_2 209..300 CDD:289560
ANK repeat 237..268 CDD:293786
ANK 266..390 CDD:238125
ANK repeat 270..300 CDD:293786
ANK repeat 303..367 CDD:293786
Ank_2 308..399 CDD:289560
ANK 364..489 CDD:238125
ANK repeat 369..400 CDD:293786
ANK repeat 402..433 CDD:293786
Ank_4 403..456 CDD:290365
ANK repeat 435..466 CDD:293786
Ank_2 440..530 CDD:289560
ANK 463..588 CDD:238125
ANK repeat 468..497 CDD:293786
ANK repeat 501..530 CDD:293786
Ank_2 506..597 CDD:289560
ANK 529..654 CDD:238125
ANK repeat 535..565 CDD:293786
ANK repeat 567..598 CDD:293786
Ank_2 572..661 CDD:289560
ANK repeat 600..630 CDD:293786
ANK repeat 633..662 CDD:293786
ANK 661..785 CDD:238125
ANK repeat 666..697 CDD:293786
Ank_2 672..762 CDD:289560
ANK repeat 699..730 CDD:293786
ANK repeat 732..762 CDD:293786
ZU5 927..1030 CDD:128514
Death_ank 1417..1497 CDD:260029
ER-remodelling 11936..>12013 CDD:258892
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.