powered by:
Protein Alignment CG42391 and ANKRD30B
DIOPT Version :9
Sequence 1: | NP_001137671.1 |
Gene: | CG42391 / 7354405 |
FlyBaseID: | FBgn0259737 |
Length: | 253 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001354536.1 |
Gene: | ANKRD30B / 374860 |
HGNCID: | 24165 |
Length: | 1525 |
Species: | Homo sapiens |
Alignment Length: | 124 |
Identity: | 32/124 - (25%) |
Similarity: | 41/124 - (33%) |
Gaps: | 52/124 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 HTNFSTELENTI-NSESNFKNISNLIKFVRQ-----HSKWYRDNDCIN---------RH------ 84
||.....||..: ..|| || :::|| |.|..:....|| ||
Human 1411 HTEQQESLEQKLFQLES--KN-----RWLRQQLVYAHKKVNKSKVTINIQFPEMKMQRHLNEKNE 1468
Fly 85 -YFNYILLDPRVTNNLKERASQLHLMDVWYTFLRAIFYVGKGKATRPYVHLKNAQKLVD 142
.||| .|:||||..|.. |.||.|..:..:..:||.|
Human 1469 EVFNY-------GNHLKERIDQYE----------------KEKAEREVIVRQLQKKLAD 1504
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165152076 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.