DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and ANKRD30B

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001354536.1 Gene:ANKRD30B / 374860 HGNCID:24165 Length:1525 Species:Homo sapiens


Alignment Length:124 Identity:32/124 - (25%)
Similarity:41/124 - (33%) Gaps:52/124 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 HTNFSTELENTI-NSESNFKNISNLIKFVRQ-----HSKWYRDNDCIN---------RH------ 84
            ||.....||..: ..||  ||     :::||     |.|..:....||         ||      
Human  1411 HTEQQESLEQKLFQLES--KN-----RWLRQQLVYAHKKVNKSKVTINIQFPEMKMQRHLNEKNE 1468

  Fly    85 -YFNYILLDPRVTNNLKERASQLHLMDVWYTFLRAIFYVGKGKATRPYVHLKNAQKLVD 142
             .|||       .|:||||..|..                |.||.|..:..:..:||.|
Human  1469 EVFNY-------GNHLKERIDQYE----------------KEKAEREVIVRQLQKKLAD 1504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105 21/81 (26%)
GIY-YIG_COG3680_Meta 85..200 CDD:198401 16/58 (28%)
ANKRD30BNP_001354536.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152076
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.