DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and ankar

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001035135.2 Gene:ankar / 368636 ZFINID:ZDB-GENE-030616-533 Length:1400 Species:Danio rerio


Alignment Length:161 Identity:39/161 - (24%)
Similarity:65/161 - (40%) Gaps:44/161 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 VWYTFLRAIFYVGKGKATRPYVHLKNAQKLVDETNNITLVKDPKLALIVSIWKANRGVLLIRAFQ 175
            ::.|||.:.....|.||....|.|   .:::..::.:||.. ..:.::|.:.::::...:|...|
Zfish  1176 IYETFLNSDNETEKAKAAFQTVVL---ARVISGSDEVTLTA-RGVTILVELLQSDQSTTVIITAQ 1236

  Fly   176 ----------GIS-----------------SQDAQTREASIIDALGMNHLTNRRLGFYYGRARSL 213
                      ||:                 |:|.:.|.| ...|||  :||..|...     |.|
Zfish  1237 LLASLAHMRAGITDAIVSMGATEHLSAHLDSEDEEVRTA-CTSALG--YLTFNRYAH-----RQL 1293

  Fly   214 SDKERKYLGIALLYKLMMKFLAKEEK--ELF 242
            ..|.||...|   |.|:||.||.:.:  :||
Zfish  1294 MTKCRKSPHI---YDLLMKNLAPDARISQLF 1321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105
GIY-YIG_COG3680_Meta 85..200 CDD:198401 23/115 (20%)
ankarNP_001035135.2 ANK 489..621 CDD:238125
Ank_2 489..599 CDD:289560
ANK repeat 520..550 CDD:293786
ANK 569..691 CDD:238125
ANK repeat 569..599 CDD:293786
Ank_2 574..663 CDD:289560
ANK repeat 601..630 CDD:293786
ANK repeat 632..662 CDD:293786
Ank_4 638..691 CDD:290365
armadillo repeat 702..726 CDD:293788
ARM 735..852 CDD:237987
armadillo repeat 736..768 CDD:293788
armadillo repeat 784..809 CDD:293788
ARM 819..937 CDD:237987
armadillo repeat 826..851 CDD:293788
armadillo repeat 868..893 CDD:293788
armadillo repeat 901..937 CDD:293788
armadillo repeat 943..977 CDD:293788
ARM 987..1109 CDD:237987
HEAT repeat 990..1019 CDD:293787
armadillo repeat 1025..1071 CDD:293788
armadillo repeat 1077..1108 CDD:293788
armadillo repeat 1165..1202 CDD:293788 8/28 (29%)
armadillo repeat 1210..1243 CDD:293788 5/33 (15%)
ARM 1212..1310 CDD:237987 24/109 (22%)
armadillo repeat 1249..1283 CDD:293788 7/36 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.