powered by:
Protein Alignment CG42391 and Asb7
DIOPT Version :9
Sequence 1: | NP_001137671.1 |
Gene: | CG42391 / 7354405 |
FlyBaseID: | FBgn0259737 |
Length: | 253 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001102385.1 |
Gene: | Asb7 / 365277 |
RGDID: | 1305154 |
Length: | 318 |
Species: | Rattus norvegicus |
Alignment Length: | 53 |
Identity: | 13/53 - (24%) |
Similarity: | 21/53 - (39%) |
Gaps: | 13/53 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 187 ASIIDALGMNHLTNRRLGFYYGR-------------ARSLSDKERKYLGIALL 226
:.||:|...:..|...:..:||| ...||||....|.:|::
Rat 107 SDIINAKSNDGWTPLHVAAHYGRDSFVRLLLEFKAEVDPLSDKGTTPLQLAII 159
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG4177 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.