DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and Asb7

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001102385.1 Gene:Asb7 / 365277 RGDID:1305154 Length:318 Species:Rattus norvegicus


Alignment Length:53 Identity:13/53 - (24%)
Similarity:21/53 - (39%) Gaps:13/53 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 ASIIDALGMNHLTNRRLGFYYGR-------------ARSLSDKERKYLGIALL 226
            :.||:|...:..|...:..:|||             ...||||....|.:|::
  Rat   107 SDIINAKSNDGWTPLHVAAHYGRDSFVRLLLEFKAEVDPLSDKGTTPLQLAII 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105
GIY-YIG_COG3680_Meta 85..200 CDD:198401 3/12 (25%)
Asb7NP_001102385.1 PHA02875 21..>241 CDD:165206 13/53 (25%)
ANK repeat 46..77 CDD:293786
ANK repeat 81..114 CDD:293786 3/6 (50%)
ANK repeat 116..147 CDD:293786 4/30 (13%)
ANK repeat 149..180 CDD:293786 3/11 (27%)
ANK repeat 213..244 CDD:293786
PTZ00322 219..>272 CDD:140343
SOCS_ASB7 273..317 CDD:239696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.