DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and Poteg

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_038950658.1 Gene:Poteg / 364620 RGDID:1359470 Length:1039 Species:Rattus norvegicus


Alignment Length:59 Identity:13/59 - (22%)
Similarity:23/59 - (38%) Gaps:21/59 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KSKVKARPISYSLG--TLHKHHTNFSTELENTINSESNFKNISNLIKFVRQHSKWYRDN 78
            ||.::..|..|.|.  |:.|     |..:.|.::.              .:|.||:::|
  Rat   659 KSYLEDTPKDYPLSKPTVEK-----SDYVPNEVSD--------------MKHGKWFQEN 698

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105 7/42 (17%)
GIY-YIG_COG3680_Meta 85..200 CDD:198401
PotegXP_038950658.1 ANK repeat 51..78 CDD:293786
ANKYR <77..203 CDD:223738
ANK repeat 82..111 CDD:293786
ANK repeat 116..144 CDD:293786
PHA03095 132..>304 CDD:222980
ANK repeat 146..177 CDD:293786
ANK repeat 179..210 CDD:293786
ANK repeat 212..243 CDD:293786
PTZ00121 <497..917 CDD:173412 13/59 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345579
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.