DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and Hace1

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_006256657.1 Gene:Hace1 / 361866 RGDID:1306114 Length:916 Species:Rattus norvegicus


Alignment Length:221 Identity:40/221 - (18%)
Similarity:76/221 - (34%) Gaps:78/221 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FNFIQTIPLQLRNNFKSKVKARPISYSLGTLHKH-----------HTNFSTELENTI---NSESN 57
            |:|:...| :|.:.|...:||:|........::|           |...|   ||.|   :.:|.
  Rat   509 FHFLLECP-ELMSRFMHIIKAQPFKDRCEWFYEHLHSGQPDSDMVHRPVS---ENDILLVHRDSI 569

  Fly    58 FKNISNLIK-----------FVRQHS----------KWY-------------------------- 75
            |::...::.           .||.|.          :|:                          
  Rat   570 FRSSCEIVSKANCAKLKQGIAVRFHGEEGMGQGVVREWFDILSNEIVNPDYALFTQSADGTTFQP 634

  Fly    76 RDNDCINRHYFNYILLDPRVTNNLKERASQLHLMDVWYT--FLRAIFYVG---KGKATRPYVHLK 135
            ..|..:|..:.||.....::   |....:...|:::::|  |.:.|..:.   :..|:....:.|
  Rat   635 NSNSYVNPDHLNYFRFAGQI---LGLALNHRQLVNIYFTRSFYKHILGIPVNYQDVASIDPEYAK 696

  Fly   136 NAQKLVDETNNITLVKDPKLALIVSI 161
            |.|.::|  |:|:   |..|.|..|:
  Rat   697 NLQWILD--NDIS---DLGLELTFSV 717

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105 17/124 (14%)
GIY-YIG_COG3680_Meta 85..200 CDD:198401 18/82 (22%)
Hace1XP_006256657.1 ANK repeat 66..95 CDD:293786
ANK 66..93 CDD:197603
Ank_2 69..194 CDD:289560
ANK 92..217 CDD:238125
ANK repeat 97..128 CDD:293786
ANK repeat 130..161 CDD:293786
Ank_2 135..222 CDD:289560
ANK repeat 163..194 CDD:293786
ANK repeat 196..221 CDD:293786
Ank_4 199..249 CDD:290365
HECTc 561..910 CDD:238033 27/165 (16%)
HECTc 586..909 CDD:214523 24/140 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.