DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and Ankle1

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_006253021.1 Gene:Ankle1 / 361122 RGDID:1308184 Length:512 Species:Rattus norvegicus


Alignment Length:171 Identity:70/171 - (40%)
Similarity:99/171 - (57%) Gaps:6/171 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 KWYRDNDCINRHYFNYILLDPRVTNNLKERASQLHLMDVWYTFLRAIFYVGKGKATRPYVHLKNA 137
            ||   .:.|.:..|.|:|||||:|.:|..|||.|.|......|:|||||||||...||..||..|
  Rat   341 KW---REGITKSSFTYLLLDPRLTKDLPARASSLTLAQCLQCFVRAIFYVGKGTRARPDAHLWEA 402

  Fly   138 QKLVDETNNITLVKDPKLALIVSIWKANRGVLLIRAFQGISSQDAQTREASIIDALGMNHLTNRR 202
            :...|:......   ||:..|:.||.:.||::.:..||.:.:.:|.||||.::||||:..|||::
  Rat   403 RGYHDQPRKQVC---PKIRRILDIWDSGRGIISLHCFQHVVAVEAYTREACLLDALGLQTLTNQK 464

  Fly   203 LGFYYGRARSLSDKERKYLGIALLYKLMMKFLAKEEKELFP 243
            .|.|||.........|:.||:.||.:.::.|||:.|:||.|
  Rat   465 QGHYYGVVAHWPLPRRRRLGVYLLQRALLVFLAEGERELRP 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105 12/27 (44%)
GIY-YIG_COG3680_Meta 85..200 CDD:198401 49/114 (43%)
Ankle1XP_006253021.1 Ank_2 22..106 CDD:289560
ANK 23..128 CDD:238125
ANK repeat 75..106 CDD:293786
Ank_4 77..128 CDD:290365
LEM 266..303 CDD:295412
GIY-YIG_COG3680_Meta 350..462 CDD:198401 49/114 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1451150at2759
OrthoFinder 1 1.000 - - FOG0005201
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.