Sequence 1: | NP_001137671.1 | Gene: | CG42391 / 7354405 | FlyBaseID: | FBgn0259737 | Length: | 253 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001264262.1 | Gene: | ANKRD62 / 342850 | HGNCID: | 35241 | Length: | 917 | Species: | Homo sapiens |
Alignment Length: | 264 | Identity: | 53/264 - (20%) |
---|---|---|---|
Similarity: | 101/264 - (38%) | Gaps: | 46/264 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 KSKVKARPISYSLGTLHKH-HTNFST-ELENTINSESNF--KNISNL------IKFVRQ--HSKW 74
Fly 75 YRDNDCI--NRHYFNYILL--DPRVTNNLKERASQLHLMDVWYTFLRAIFYVGKGKATRPYVHLK 135
Fly 136 N-----AQKLVDETNNITLVKDPKLAL--IVSIW-----KANRGVLLI--------RAFQGISSQ 180
Fly 181 DAQTREASIIDALGMNHLTNRRLGFYYGRARSLSDKERKYLGIALLYKLMMKFLAKE---EKELF 242
Fly 243 PLKN 246 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42391 | NP_001137671.1 | Peptidase_S80 | <37..>101 | CDD:305105 | 17/79 (22%) |
GIY-YIG_COG3680_Meta | 85..200 | CDD:198401 | 22/136 (16%) | ||
ANKRD62 | NP_001264262.1 | Ank_4 | 42..92 | CDD:290365 | |
ANK repeat | 42..69 | CDD:293786 | |||
ANK | 66..191 | CDD:238125 | |||
ANK 1 | 71..100 | ||||
ANK repeat | 73..102 | CDD:293786 | |||
Ank_2 | 76..167 | CDD:289560 | |||
ANK repeat | 104..135 | CDD:293786 | |||
ANK 2 | 104..133 | ||||
ANK | 132..256 | CDD:238125 | |||
ANK repeat | 137..167 | CDD:293786 | |||
ANK 3 | 137..166 | ||||
Ank_2 | 142..234 | CDD:289560 | |||
ANK repeat | 170..201 | CDD:293786 | |||
ANK 4 | 170..199 | ||||
ANK repeat | 203..234 | CDD:293786 | |||
ANK 5 | 203..232 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 265..367 | ||||
CCDC144C | 561..846 | CDD:291576 | 43/228 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165152082 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |