DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and ANKRD62

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001264262.1 Gene:ANKRD62 / 342850 HGNCID:35241 Length:917 Species:Homo sapiens


Alignment Length:264 Identity:53/264 - (20%)
Similarity:101/264 - (38%) Gaps:46/264 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KSKVKARPISYSLGTLHKH-HTNFST-ELENTINSESNF--KNISNL------IKFVRQ--HSKW 74
            :||:..:.:...|.|:..: :.||.| |.|..:..|::.  ..|:.|      ||...|  .:|:
Human   525 QSKLTLKSLEVELKTVRSNSNQNFHTHERERDLWQENHLMRDEIARLRLEIDTIKHQNQETENKY 589

  Fly    75 YRDNDCI--NRHYFNYILL--DPRVTNNLKERASQLHLMDVWYTFLRAIFYVGKGKATRPYVHLK 135
            ::|.:.|  |.......|.  :..:|..:...:.:|:::....|.|.:.....|...:|....::
Human   590 FKDIEIIKENNEDLEKTLKRNEEALTKTITRYSKELNVLMDENTMLNSELQKEKQSMSRLETEME 654

  Fly   136 N-----AQKLVDETNNITLVKDPKLAL--IVSIW-----KANRGVLLI--------RAFQGISSQ 180
            :     |..|.|.....:..:|.:||.  .|:.|     ..|..:.::        ....|:.::
Human   655 SYRCRLAAALCDHDQRQSSKRDLQLAFQSTVNEWCHLQEDTNSHIQILSQQLSKAESTSSGLETE 719

  Fly   181 DAQTREASIIDALGMNHLTNRRLGFYYGRARSLSDKERKYLGIALLYKLMMKFLAKE---EKELF 242
            ....|||.....|.:.|:.    |......|.|.|.|..|...   ..::.|::.|:   |..||
Human   720 LHYEREALKEKTLHIEHMQ----GVLSRTQRRLEDIEHMYQND---QPILEKYVRKQQSVEDGLF 777

  Fly   243 PLKN 246
            .|::
Human   778 QLQS 781

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105 17/79 (22%)
GIY-YIG_COG3680_Meta 85..200 CDD:198401 22/136 (16%)
ANKRD62NP_001264262.1 Ank_4 42..92 CDD:290365
ANK repeat 42..69 CDD:293786
ANK 66..191 CDD:238125
ANK 1 71..100
ANK repeat 73..102 CDD:293786
Ank_2 76..167 CDD:289560
ANK repeat 104..135 CDD:293786
ANK 2 104..133
ANK 132..256 CDD:238125
ANK repeat 137..167 CDD:293786
ANK 3 137..166
Ank_2 142..234 CDD:289560
ANK repeat 170..201 CDD:293786
ANK 4 170..199
ANK repeat 203..234 CDD:293786
ANK 5 203..232
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 265..367
CCDC144C 561..846 CDD:291576 43/228 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152082
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.