DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and CG3104

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001259969.1 Gene:CG3104 / 33486 FlyBaseID:FBgn0031473 Length:321 Species:Drosophila melanogaster


Alignment Length:137 Identity:34/137 - (24%)
Similarity:56/137 - (40%) Gaps:27/137 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 HLKNAQKLVDETNNITL-VKDPKLALIVSIWKANRGV--LLIRA--------FQG-----ISSQD 181
            |:|..::|:|...|:.. :||....:.:|....:|.|  |||:|        ..|     |::|.
  Fly   121 HVKIVRELLDCGANVNAHMKDRATPVFISAQNGHRTVLSLLIQAGAEIDIKRIDGATPLWIAAQM 185

  Fly   182 AQTREASIIDALGMNHLTNRRLGFYYGRARSLSDKERKYLGIALLYKLMMKFLAKEEKELFPLKN 246
            .|.....::...|.|..|.|..|     |..|.....|  |.|.:..:::|:    ...|..|.|
  Fly   186 GQDHICKVLLQNGANVDTVRCDG-----ATPLFKAAHK--GHAAVITVLLKY----RPNLGQLPN 239

  Fly   247 TKAAMAA 253
            .::|:.|
  Fly   240 GESALHA 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105
GIY-YIG_COG3680_Meta 85..200 CDD:198401 20/82 (24%)
CG3104NP_001259969.1 Ank_2 <13..72 CDD:289560
ANK repeat 13..40 CDD:293786
ANK 37..162 CDD:238125 11/40 (28%)
ANK repeat 42..73 CDD:293786
Ank_2 47..137 CDD:289560 5/15 (33%)
ANK repeat 75..106 CDD:293786
ANK 103..228 CDD:238125 28/113 (25%)
ANK repeat 108..137 CDD:293786 5/15 (33%)
Ank_2 113..202 CDD:289560 20/80 (25%)
ANK repeat 141..171 CDD:293786 8/29 (28%)
ANK 169..292 CDD:238125 20/89 (22%)
ANK repeat 174..204 CDD:293786 6/29 (21%)
Ank_2 179..270 CDD:289560 19/79 (24%)
ANK repeat 207..237 CDD:293786 8/40 (20%)
ANK repeat 239..270 CDD:293786 3/8 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.