DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and Ankef1

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_783598.1 Gene:Ankef1 / 319196 MGIID:2441685 Length:775 Species:Mus musculus


Alignment Length:78 Identity:18/78 - (23%)
Similarity:27/78 - (34%) Gaps:33/78 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IQTIPLQLRNNFKSKVKARPISYSLGTLHKHHTNFSTELENTINSESNFKNISNLIKFVRQH--- 71
            |.|||   .|.|..:....|..|.:.|                     ::|:|:..:|.|.|   
Mouse   435 ICTIP---ENAFPRRPDGGPPYYMIET---------------------YQNVSDSHRFNRDHPPE 475

  Fly    72 ------SKWYRDN 78
                  |:||.|:
Mouse   476 HPIQDDSEWYIDD 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105 9/51 (18%)
GIY-YIG_COG3680_Meta 85..200 CDD:198401
Ankef1NP_783598.1 ANK 47..161 CDD:238125
ANK repeat 47..78 CDD:293786
ANK 1 47..76
Ank_2 52..143 CDD:289560
ANK repeat 80..111 CDD:293786
ANK repeat 113..143 CDD:293786
ANK 143..270 CDD:238125
ANK 2 184..213
ANK repeat 185..215 CDD:293786
Ank_2 189..277 CDD:289560
ANK repeat 217..248 CDD:293786
ANK 3 217..246
ANK repeat 250..281 CDD:293786
ANK 4 250..279
EFh 340..395 CDD:298682
Ank_2 <501..555 CDD:289560
ANK 519..643 CDD:238125
ANK 5 524..553
ANK repeat 527..555 CDD:293786
Ank_2 529..621 CDD:289560
ANK repeat 557..588 CDD:293786
ANK 6 557..586
ANK repeat 590..621 CDD:293786
ANK 7 590..619
ANK 8 623..652
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.