| Sequence 1: | NP_001137671.1 | Gene: | CG42391 / 7354405 | FlyBaseID: | FBgn0259737 | Length: | 253 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_232319.5 | Gene: | Ankrd26 / 312667 | RGDID: | 1310736 | Length: | 1675 | Species: | Rattus norvegicus |
| Alignment Length: | 195 | Identity: | 40/195 - (20%) |
|---|---|---|---|
| Similarity: | 67/195 - (34%) | Gaps: | 27/195 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 29 PISYSLGTLHKHHTNFSTELENTINSESNFKN---------ISNLIKFVRQHSKWYRDNDCINRH 84
Fly 85 YFNYILLDPRVTNNLKERASQLHLMDVWYTFLRAI------FYVGKGKATRPYVHLKNAQKLVDE 143
Fly 144 TNNI-TLVKDPKLALIVSIWKANRGVLLIRAFQGISSQDAQTREASIIDALGMNHLTNRRLGFYY 207
Fly 208 207 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG42391 | NP_001137671.1 | Peptidase_S80 | <37..>101 | CDD:305105 | 9/72 (13%) |
| GIY-YIG_COG3680_Meta | 85..200 | CDD:198401 | 25/121 (21%) | ||
| Ankrd26 | XP_232319.5 | Ank_4 | 51..101 | CDD:290365 | |
| ANK repeat | 51..78 | CDD:293786 | |||
| ANK | 75..200 | CDD:238125 | |||
| ANK repeat | 82..111 | CDD:293786 | |||
| Ank_2 | 85..177 | CDD:289560 | |||
| ANK repeat | 113..144 | CDD:293786 | |||
| ANK repeat | 146..177 | CDD:293786 | |||
| ANK repeat | 179..210 | CDD:293786 | |||
| Syntaphilin | <787..>922 | CDD:291936 | 1/3 (33%) | ||
| CCDC144C | 880..1183 | CDD:291576 | |||
| DASH_Spc19 | <1213..1314 | CDD:285487 | |||
| DUF3496 | 1489..1596 | CDD:288825 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C166345583 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||