DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42391 and Ankrd42

DIOPT Version :9

Sequence 1:	NP_001137671.1	Gene:	CG42391 / 7354405	FlyBaseID:	FBgn0259737	Length:	253	Species:	Drosophila melanogaster
Sequence 2:	XP_017444434.1	Gene:	Ankrd42 / 293117	RGDID:	1310789	Length:	522	Species:	Rattus norvegicus

Alignment Length:	50	Identity:	13/50 - (26%)
Similarity:	20/50 - (40%)	Gaps:	11/50 - (22%)

- Green bases have known domain annotations that are detailed below.

  Fly    15 LQLRNNFKSKVKARPISYSLGTLHKHHTNFSTELENTINSESNFKNISNL 64
            |.|..:.|:..:.|        .||........||   .:|||||::..:
  Rat   392 LSLSESDKANARMR--------AHKKIVELRQLLE---IAESNFKHLGGI 430

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42391	NP_001137671.1	Peptidase_S80	<37..>101	CDD:305105	9/27 (33%)
CG42391	NP_001137671.1	GIY-YIG_COG3680_Meta	85..200	CDD:198401
Ankrd42	XP_017444434.1	None
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG4177
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900