powered by:
Protein Alignment CG42391 and Ankrd42
DIOPT Version :9
Sequence 1: | NP_001137671.1 |
Gene: | CG42391 / 7354405 |
FlyBaseID: | FBgn0259737 |
Length: | 253 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017444434.1 |
Gene: | Ankrd42 / 293117 |
RGDID: | 1310789 |
Length: | 522 |
Species: | Rattus norvegicus |
Alignment Length: | 50 |
Identity: | 13/50 - (26%) |
Similarity: | 20/50 - (40%) |
Gaps: | 11/50 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 LQLRNNFKSKVKARPISYSLGTLHKHHTNFSTELENTINSESNFKNISNL 64
|.|..:.|:..:.| .||........|| .:|||||::..:
Rat 392 LSLSESDKANARMR--------AHKKIVELRQLLE---IAESNFKHLGGI 430
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG4177 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.