DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and ANK3

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_066267.2 Gene:ANK3 / 288 HGNCID:494 Length:4377 Species:Homo sapiens


Alignment Length:223 Identity:44/223 - (19%)
Similarity:68/223 - (30%) Gaps:86/223 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 TELENTINSESNFKNISNLIKFVRQHSK--WYRDNDCINRHYFNYILLDPRVTNNLKERASQLH- 107
            |.:.||.||:..          ||.|.|  :.:||       ||.       .|||.....|.. 
Human  3761 TMISNTANSQMG----------VRPHEKHDFQKDN-------FNN-------NNNLDSSTIQTDN 3801

  Fly   108 -LMDVWYTFLRAIFYVGKGKATRPYVHLKNAQKLVDETNNITLVKDPKLALIVSIWKANRGVL-- 169
             :.::..|                 .|  :|.....|.:|...|...|          ..|||  
Human  3802 IMSNIVLT-----------------EH--SAPTCTTEKDNPVKVSSGK----------KTGVLQG 3837

  Fly   170 -LIRAFQGISSQDAQTRE--------------ASIIDALGMNHLTNRRLGFYYGRARSLSDKERK 219
             .:|..|.:..:..:|:|              .|..|....||::|.:.    .:.:.:|..|:.
Human  3838 HCVRDKQKVLGEQQKTKELIGIRQKSKLPIKATSPKDTFPPNHMSNTKA----SKMKQVSQSEKT 3898

  Fly   220 YLGIALLYKLMMKFLAKEEKELFPLKNT 247
                    |.:......:.|...|:|||
Human  3899 --------KALTTSSCVDVKSRIPVKNT 3918

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105 16/56 (29%)
GIY-YIG_COG3680_Meta 85..200 CDD:198401 24/133 (18%)
ANK3NP_066267.2 ANK 6 234..263
ANK repeat 267..298 CDD:293786
ANK 7 267..296
Ank_2 272..363 CDD:289560
ANK 295..420 CDD:238125
ANK 8 300..329
ANK repeat 300..325 CDD:293786
ANK repeat 333..364 CDD:293786
ANK 9 333..362
ANK 361..486 CDD:238125
ANK 10 366..395
ANK repeat 369..397 CDD:293786
Ank_2 371..463 CDD:289560
ANK repeat 399..430 CDD:293786
ANK 11 399..428
ANK repeat 432..463 CDD:293786
ANK 12 432..461
ANK 460..585 CDD:238125
ANK repeat 465..496 CDD:293786
ANK 13 465..494
Ank_2 470..561 CDD:289560
ANK repeat 498..529 CDD:293786
ANK 14 498..527
ANK repeat 531..560 CDD:293786
ANK 15 531..560
Ank_2 536..626 CDD:289560
ANK 560..684 CDD:238125
ANK repeat 564..593 CDD:293786
ANK 16 564..593
ANK repeat 597..626 CDD:293786
ANK 17 597..626
ANK repeat 630..660 CDD:293786
ANK 18 630..659
Ank_4 631..684 CDD:290365
ANK 658..783 CDD:238125
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44
Ank_4 47..94 CDD:290365
ANK 68..193 CDD:238125
ANK repeat 73..104 CDD:293786
ANK 1 73..102
Ank_2 78..164 CDD:289560
ANK repeat 106..137 CDD:293786
ANK 2 106..135
ANK 3 139..168
ANK repeat 139..164 CDD:293786
Ank_4 140..193 CDD:290365
ANK 4 172..201
ANK 5 203..230
ANK repeat 205..232 CDD:293786
Ank_2 206..297 CDD:289560
ANK 229..354 CDD:238125
ANK repeat 234..265 CDD:293786
ANK repeat 663..694 CDD:293786
ANK 19 663..692
Ank_2 669..759 CDD:289560
ANK repeat 696..727 CDD:293786
ANK 20 696..725
ANK repeat 729..760 CDD:293786
ANK 21 729..758
Ank_5 749..803 CDD:290568
ANK 22 762..791
ANK repeat 762..790 CDD:293786
ANK 23 795..825
ZU5 982..1086 CDD:128514
UPA domain. /evidence=ECO:0000250 1273..1407
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1519..1540
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1968..1987
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2107..2159
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2176..2245
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2299..2322
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2383..2433
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2474..2508
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2588..2751
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2795..2824
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 3036..3067
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 3131..3272
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 3298..3516
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 3538..3607
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 3635..3718
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 3868..3897 6/32 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 4019..4090
Death_ank3 4088..4171 CDD:176781
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 4251..4298
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 4323..4377
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.