DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42391 and Ankdd1b

DIOPT Version :9

Sequence 1:	NP_001137671.1	Gene:	CG42391 / 7354405	FlyBaseID:	FBgn0259737	Length:	253	Species:	Drosophila melanogaster
Sequence 2:	XP_006517744.1	Gene:	Ankdd1b / 271144	MGIID:	2444730	Length:	575	Species:	Mus musculus

Alignment Length:	97	Identity:	26/97 - (26%)
Similarity:	40/97 - (41%)	Gaps:	27/97 - (27%)

- Green bases have known domain annotations that are detailed below.

  Fly   127 ATRPYVHLKNAQKLVDETNNITLVKDPKLALIVSIWKANRGVLLI-RAFQGISSQDAQTREASII 190
            ||||:..|....|        ..|:||:.|.     ..:.|:|.| |:||..    |::....::
Mouse    30 ATRPWRSLARMPK--------PEVQDPETAA-----AGHEGLLAIERSFQNA----AKSSNLDLM 77

  Fly   191 DAL--------GMNHLTNRRLGFYYGRARSLS 214
            :.|        .:|::....|.|..|| .|||
Mouse    78 EKLFEKKVNINAVNNMNRTALHFAVGR-NSLS 108

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42391	NP_001137671.1	Peptidase_S80	<37..>101	CDD:305105
CG42391	NP_001137671.1	GIY-YIG_COG3680_Meta	85..200	CDD:198401	19/81 (23%)
Ankdd1b	XP_006517744.1	PHA02876	<63..>413	CDD:165207	13/51 (25%)
		ANK repeat	93..124	CDD:293786	7/17 (41%)
		ANK repeat	126..157	CDD:293786
		ANK repeat	163..192	CDD:293786
		ANK repeat	194..225	CDD:293786
		ANK repeat	227..258	CDD:293786
		ANK repeat	260..291	CDD:293786
		ANK repeat	293..321	CDD:293786
		ANK repeat	330..357	CDD:293786
		ANK repeat	359..390	CDD:293786
		DD	466..>508	CDD:387368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG4177
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900