DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and ANKRD18A

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_024303251.1 Gene:ANKRD18A / 253650 HGNCID:23643 Length:1170 Species:Homo sapiens


Alignment Length:258 Identity:44/258 - (17%)
Similarity:93/258 - (36%) Gaps:61/258 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PISYSLGTLHKHHTNFSTELENTINSESNFK----------NISNLIKFVRQHSKWYRDNDCINR 83
            |:.:::.:..:|...|..:.:..|::..|||          |:|:::..:.|.:......|...:
Human   170 PLLFAINSRRQHMVEFLLKNQANIHAVDNFKRTALILAVQHNLSSIVTLLLQQNIRISSQDMFGQ 234

  Fly    84 HYFNYILLDPRVTNNLKERASQL--HLMDVWYTFLRAIFYVGKGKATRPYVHLKNAQKLVDETNN 146
            ...:|.|     .::|:....|:  |                |.|..:.::...|.:....:..|
Human   235 TAEDYAL-----CSDLRSIRQQILEH----------------KNKMLKNHLRNDNQETAAMKPAN 278

  Fly   147 ITLVKDPKLA----LIVSIWKANRGVLLIRAFQGISSQDAQTREASIIDALGMNHLTNRRLGF-- 205
            :...|:...|    .:.|..|..|    ::..:....||:|: .....||:..|.:..:.:..  
Human   279 LKKRKERAKAEHNLKVASEEKQER----LQRSENKQPQDSQS-YGKKKDAMYGNFMLKKDIAMLK 338

  Fly   206 --YYGRARSLSDKERKYL---------------GIALLYKLMMKFLAKEEKELFPLKNTKAAM 251
              .|........||:||:               .:.|..|::.|.:|:..::|..||...|.:
Human   339 EELYAIKNDSLRKEKKYIQEIKSITEINANFEKSVRLNEKMITKTVARYSQQLNDLKAENARL 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105 13/73 (18%)
GIY-YIG_COG3680_Meta 85..200 CDD:198401 20/120 (17%)
ANKRD18AXP_024303251.1 Ank_4 34..88 CDD:316185
ANK repeat 38..65 CDD:293786
ANK 62..187 CDD:238125 3/16 (19%)
ANK repeat 69..98 CDD:293786
ANK repeat 100..131 CDD:293786
ANK 128..253 CDD:238125 15/87 (17%)
ANK repeat 133..164 CDD:293786
ANK repeat 166..197 CDD:293786 4/26 (15%)
ANK repeat 199..230 CDD:293786 5/30 (17%)
CCDC144C 327..617 CDD:317340 14/75 (19%)
SMC_N <460..907 CDD:330553
DUF3496 865..969 CDD:314818
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152066
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.