Sequence 1: | NP_001137671.1 | Gene: | CG42391 / 7354405 | FlyBaseID: | FBgn0259737 | Length: | 253 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_024303251.1 | Gene: | ANKRD18A / 253650 | HGNCID: | 23643 | Length: | 1170 | Species: | Homo sapiens |
Alignment Length: | 258 | Identity: | 44/258 - (17%) |
---|---|---|---|
Similarity: | 93/258 - (36%) | Gaps: | 61/258 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 PISYSLGTLHKHHTNFSTELENTINSESNFK----------NISNLIKFVRQHSKWYRDNDCINR 83
Fly 84 HYFNYILLDPRVTNNLKERASQL--HLMDVWYTFLRAIFYVGKGKATRPYVHLKNAQKLVDETNN 146
Fly 147 ITLVKDPKLA----LIVSIWKANRGVLLIRAFQGISSQDAQTREASIIDALGMNHLTNRRLGF-- 205
Fly 206 --YYGRARSLSDKERKYL---------------GIALLYKLMMKFLAKEEKELFPLKNTKAAM 251 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42391 | NP_001137671.1 | Peptidase_S80 | <37..>101 | CDD:305105 | 13/73 (18%) |
GIY-YIG_COG3680_Meta | 85..200 | CDD:198401 | 20/120 (17%) | ||
ANKRD18A | XP_024303251.1 | Ank_4 | 34..88 | CDD:316185 | |
ANK repeat | 38..65 | CDD:293786 | |||
ANK | 62..187 | CDD:238125 | 3/16 (19%) | ||
ANK repeat | 69..98 | CDD:293786 | |||
ANK repeat | 100..131 | CDD:293786 | |||
ANK | 128..253 | CDD:238125 | 15/87 (17%) | ||
ANK repeat | 133..164 | CDD:293786 | |||
ANK repeat | 166..197 | CDD:293786 | 4/26 (15%) | ||
ANK repeat | 199..230 | CDD:293786 | 5/30 (17%) | ||
CCDC144C | 327..617 | CDD:317340 | 14/75 (19%) | ||
SMC_N | <460..907 | CDD:330553 | |||
DUF3496 | 865..969 | CDD:314818 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165152066 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |