DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and Ankle1

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_766344.2 Gene:Ankle1 / 234396 MGIID:1918775 Length:534 Species:Mus musculus


Alignment Length:171 Identity:70/171 - (40%)
Similarity:99/171 - (57%) Gaps:6/171 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 KWYRDNDCINRHYFNYILLDPRVTNNLKERASQLHLMDVWYTFLRAIFYVGKGKATRPYVHLKNA 137
            ||   .:.|.:..|.|:|||||:|.:|..|||.|.|.:....|:|||||||||...||..||..|
Mouse   363 KW---REGITKSSFTYLLLDPRLTKDLPARASSLTLAECLQCFVRAIFYVGKGTRARPDAHLWEA 424

  Fly   138 QKLVDETNNITLVKDPKLALIVSIWKANRGVLLIRAFQGISSQDAQTREASIIDALGMNHLTNRR 202
            ....|:......   ||:..|:.||.:.||::.:..||.:.:.:|.||||.::||||:..|||::
Mouse   425 FGYHDQPRKQVC---PKVRRILDIWASGRGIISLHCFQHVVAMEAYTREACLLDALGLQTLTNQK 486

  Fly   203 LGFYYGRARSLSDKERKYLGIALLYKLMMKFLAKEEKELFP 243
            .|.|||.........|:.||:.||.:.::.|||:.|:||.|
Mouse   487 QGHYYGVVAHWPPSRRRRLGVHLLQRALLVFLAEGERELRP 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105 12/27 (44%)
GIY-YIG_COG3680_Meta 85..200 CDD:198401 49/114 (43%)
Ankle1NP_766344.2 ANK 1. /evidence=ECO:0000255 4..35
ANK 26..128 CDD:238125
Ank_2 26..106 CDD:289560
ANK 2. /evidence=ECO:0000255 39..71
ANK repeat 75..106 CDD:293786
ANK 3. /evidence=ECO:0000255 75..104
Ank_4 76..128 CDD:290365
ANK 4. /evidence=ECO:0000255 108..137
LEM 285..322 CDD:295412
GIY-YIG_COG3680_Meta 372..484 CDD:198401 49/114 (43%)
Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:Q8NAG6 498..505 1/6 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005201
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3306
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.