DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and ANKRD26

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_016871417.1 Gene:ANKRD26 / 22852 HGNCID:29186 Length:2112 Species:Homo sapiens


Alignment Length:306 Identity:47/306 - (15%)
Similarity:115/306 - (37%) Gaps:75/306 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKLLVFNFIQTIPLQLRNNFKSKVKARPISYSLGTLHKHHTNFSTELENTINSESNFKNISNLI 65
            :|.|...|.:....|:.....|.:::|...||        |:..:..:.:...||::.:.:....
Human  1340 LSVLTAENAMLNSKLENEKQSKERLEAEVESY--------HSRLAAAIHDRDQSETSKRELELAF 1396

  Fly    66 KFVRQHSKWYRD------------NDCINRHYF------NYILLD---------------PRVTN 97
            :..|......:|            |:.:::..|      |.:.::               .||..
Human  1397 QRARDECSRLQDKMNFDVSNLKDNNEILSQQLFKTESKLNSLEIEFHHTRDALREKTLGLERVQK 1461

  Fly    98 NLKERASQLHLMDVWY--TFLRAIFYVGKGKATRPYVHLKNAQKL-----VDETNNITLVKDPKL 155
            :|.:...|:..|:..|  ..::...|:||.::....:....::.:     :|:.:|   ..|.|.
Human  1462 DLSQTQCQMKEMEQKYQNEQVKVNKYIGKQESVEERLSQLQSENMLLRQQLDDAHN---KADNKE 1523

  Fly   156 ALIVSIWKANRGVLLIRAFQGISSQDA---QTREASIIDALGMNHLTNRRLGFYYGRA------- 210
            ..:::|  .::...:::..|..|.:.:   :.|...:|..  .|||..|:..:...:|       
Human  1524 KTVINI--QDQFHAIVQKLQAESEKQSLLLEERNKELISE--CNHLKERQYQYENEKAEREVVVR 1584

  Fly   211 ---RSLSDKERKY------LGIALLYKLMMKFLAKE-EKELFPLKN 246
               :.|:|..:|.      |.:...|::.::...:: :|:|..::|
Human  1585 QLQQELADTLKKQSMSEASLEVTSRYRINLEDETQDLKKKLGQIRN 1630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105 11/96 (11%)
GIY-YIG_COG3680_Meta 85..200 CDD:198401 23/145 (16%)
ANKRD26XP_016871417.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152084
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.