DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42391 and Tnks

DIOPT Version :9

Sequence 1:	NP_001137671.1	Gene:	CG42391 / 7354405	FlyBaseID:	FBgn0259737	Length:	253	Species:	Drosophila melanogaster
Sequence 2:	NP_780300.2	Gene:	Tnks / 21951	MGIID:	1341087	Length:	1320	Species:	Mus musculus

Alignment Length:	160	Identity:	38/160 - (23%)
Similarity:	58/160 - (36%)	Gaps:	35/160 - (21%)

- Green bases have known domain annotations that are detailed below.

  Fly    78 NDCINRHYFNYILLDPRVTNNLKERASQLHLMDVW-YTFLRAIFYVGKGKATRPYVHLKN----A 137
            |.|...||        .|...|....:.:::.|:| :|.|...  ..|||.....:.||:    .
Mouse   716 NACSYGHY--------EVAELLVRHGASVNVADLWKFTPLHEA--AAKGKYEICKLLLKHGADPT 770

  Fly   138 QKLVDETNNITLVKDPKLALIVSIWKANRG--VLLIRAFQG-------------ISSQDAQTREA 187
            :|..|....:.|||:..    ..|....||  .||..|.:|             |:.:|.|.|.:
Mouse   771 KKNRDGNTPLDLVKEGD----TDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNS 831

  Fly   188 SIID-ALGMNHLTNRRLGFYYGRARSLSDK 216
            :.:. |.|.|:|........:|...:..||
Mouse   832 TPLHLAAGYNNLEVAEYLLEHGADVNAQDK 861

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42391	NP_001137671.1	Peptidase_S80	<37..>101	CDD:305105	6/22 (27%)
CG42391	NP_001137671.1	GIY-YIG_COG3680_Meta	85..200	CDD:198401	32/135 (24%)
Tnks	NP_780300.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..88
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	111..152
		ANK 1	174..202
		ANK	201..315	CDD:238125
		ANK 2	208..237
		ANK repeat	211..239	CDD:293786
		Ank_2	213..305	CDD:289560
		ANK repeat	241..272	CDD:293786
		ANK 3	241..270
		ANK	269..448	CDD:238125
		ANK repeat	274..305	CDD:293786
		ANK 4	274..303
		Ank_4	332..382	CDD:290365
		ANK 5	361..390
		ANK repeat	364..392	CDD:293786
		Ank_2	366..458	CDD:289560
		ANK repeat	394..425	CDD:293786
		ANK 6	394..423
		ANK repeat	427..458	CDD:293786
		ANK 7	427..456
		ANK 8	514..546
		ANK	516..632	CDD:238125
		ANK repeat	516..548	CDD:293786
		Ank_2	519..612	CDD:289560
		ANK repeat	550..581	CDD:293786
		ANK 9	550..579
		ANK repeat	583..612	CDD:293786
		ANK 10	583..612
		Ank_2	588..707	CDD:289560
		ANK	669..794	CDD:238125	21/91 (23%)
		ANK 11	676..705
		ANK repeat	679..707	CDD:293786
		Ank_2	681..773	CDD:289560	15/66 (23%)
		ANK repeat	709..740	CDD:293786	6/31 (19%)
		ANK 12	709..738		6/29 (21%)
		ANK repeat	742..773	CDD:293786	8/32 (25%)
		ANK 13	742..771		8/30 (27%)
		ANK 14	775..803		9/31 (29%)
		Ank_4	796..850	CDD:290365	13/53 (25%)
		ANK	822..946	CDD:238125	10/40 (25%)
		ANK repeat	829..860	CDD:293786	6/30 (20%)
		ANK 15	829..858		6/28 (21%)
		Ank_2	834..926	CDD:289560	7/28 (25%)
		ANK repeat	862..893	CDD:293786	38/160 (24%)
		ANK 16	862..891		38/160 (24%)
		ANK repeat	895..926	CDD:293786
		ANK 17	895..924
		ANK 18	928..957
		SAM_tankyrase1,2	1017..1082	CDD:188923
		SAM	1023..1080	CDD:197735
		tankyrase_like	1084..1306	CDD:238718
		PARP	1098..1301	CDD:279038
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG4177
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900