DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and K07D4.2

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001367953.1 Gene:K07D4.2 / 187107 WormBaseID:WBGene00019483 Length:194 Species:Caenorhabditis elegans


Alignment Length:143 Identity:43/143 - (30%)
Similarity:64/143 - (44%) Gaps:19/143 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 YILLDPRVTNNLKERASQLHLMDVWYTFLRAIFYVGKGKATRPYVHLKNAQKLVDETNNITLVKD 152
            |:|::|.|   |.:...::.|.    |||.:||||||||..|...:.|      |...||.  ..
 Worm    35 YVLINPYV---LDKDVREVDLA----TFLSSIFYVGKGKGERAMAYFK------DACGNIQ--GS 84

  Fly   153 PKLALIVSIWKANRGVLLIRAFQGISSQDAQTREASII----DALGMNHLTNRRLGFYYGRARSL 213
            .||..|...|.....|.....::.|....|..|||::|    :..|.::.||:..|.:.|.:...
 Worm    85 RKLTTIDQAWNKKGFVYKHIIWRPIIENLALAREAAMIFFFKNLAGKSNFTNKYNGSFKGESAFW 149

  Fly   214 SDKERKYLGIALL 226
            |.:|:...|:.||
 Worm   150 SREEKCNYGVYLL 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105 5/12 (42%)
GIY-YIG_COG3680_Meta 85..200 CDD:198401 34/115 (30%)
K07D4.2NP_001367953.1 GIY-YIG_SF 32..136 CDD:417687 34/115 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48908
OrthoDB 1 1.010 - - D1451150at2759
OrthoFinder 1 1.000 - - FOG0005201
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.