DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and F56D5.9

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_501662.2 Gene:F56D5.9 / 186386 WormBaseID:WBGene00010152 Length:1132 Species:Caenorhabditis elegans


Alignment Length:221 Identity:43/221 - (19%)
Similarity:72/221 - (32%) Gaps:71/221 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RPISYSLGTLHKHHTNF-----STELENTINSESNFKNISNLIKFVRQHSKWYRDNDCINRHYFN 87
            |.:::|..|   ..|.|     |..|||.:|..|   .:.||.|.:...::.:.|.|.....:|.
 Worm    19 RLLAFSTST---EETTFESDIKSPNLENFMNDVS---TLINLTKAISSQARLFHDFDLETSTFFK 77

  Fly    88 --------YILLDPRVTNNLKERASQLHLMDVWYTFLRAIFYVGKGKATRPYVHLKNAQKLVDET 144
                    ::.|.|..|         :.....:|..:|..:             ::..:||..:.
 Worm    78 ATPLDLQAFLALQPNET---------MAAFTKFYNEIRKSY-------------IRRFEKLKSKM 120

  Fly   145 NNITLVKDPKLALIVSIWKANRGVLLIRAFQGIS---SQDAQTREASIIDALGMNHLTNRRLGFY 206
            .|...:|.|:                .:.|..|.   |.|....:.|...||           |.
 Worm   121 PNPPDLKPPE----------------FKYFDDIEYCLSNDIDRTKLSFCFAL-----------FS 158

  Fly   207 YGRARSLSDKERKYLGIALLYKLMMK 232
            .|:...|..|:...|..:|.||.::|
 Worm   159 DGKIEELFKKDMDQLSKSLEYKNVVK 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105 17/76 (22%)
GIY-YIG_COG3680_Meta 85..200 CDD:198401 18/125 (14%)
F56D5.9NP_501662.2 ANK 791..>859 CDD:238125
Ank_4 792..843 CDD:290365
ANK repeat 793..820 CDD:293786
ANK repeat 822..853 CDD:293786
BRCT <938..996 CDD:214602
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.