DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and F36D3.5

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_507181.3 Gene:F36D3.5 / 185352 WormBaseID:WBGene00009471 Length:1215 Species:Caenorhabditis elegans


Alignment Length:250 Identity:48/250 - (19%)
Similarity:89/250 - (35%) Gaps:51/250 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IQTIPLQLRNNFKSKVKARPISYSLGTLHKHHTNFSTELENTINSESNFKNI----SNLIKFVRQ 70
            ||...:.:.|..|..:.||....|.......:..:....||.:|..:|.|:|    :..:.|:..
 Worm   402 IQDSRIHINNCMKETLLARSKLKSFDASIVEYEKYMFPAENIMNRLANIKDIIAELTVALNFMVY 466

  Fly    71 HSKWYRD---NDCINRHYFNYILLDPRVTNNLKERASQLH----LMDVWYTFLRAIFYVGKGKAT 128
            .:...||   :|| :..|:....||...:|.:..:...:.    |....|:|:..:..:.|    
 Worm   467 PNTQARDLFKDDC-HTLYWTLSKLDVNTSNAITVKNMLIRDFKKLTHHSYSFIDTMKSIAK---- 526

  Fly   129 RPYVHLKNAQKLVDETNNITLVKD-PKLALIVSIWKANRGVLLIRAFQGISSQDAQTREASII-- 190
                 :.:..|:|::|:......| |.|..:||      .:.|::..|..|......:|..:|  
 Worm   527 -----ISSELKIVEKTSAGIYDSDGPNLGDLVS------ELELVKTSQCFSHHSETIQELMLIVH 580

  Fly   191 ----DALGMNHLTNRRLGFYYGRARSLSDKERKYLGIALLYKLMMKFLAKEEKEL 241
                .....:|.|:..:..|..|...:.:.                 ||..|||:
 Worm   581 KLYSTRYPPDHATSSTMHEYLDRLEKVQNN-----------------LALVEKEI 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105 15/70 (21%)
GIY-YIG_COG3680_Meta 85..200 CDD:198401 22/125 (18%)
F36D3.5NP_507181.3 WSN 25..93 CDD:197734
ANK <873..946 CDD:238125
ANK repeat 876..907 CDD:293786
Ank_4 879..930 CDD:290365
ANK repeat 909..940 CDD:293786
BRCT 985..1065 CDD:214602
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.