DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and C01G10.1

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_506722.2 Gene:C01G10.1 / 180019 WormBaseID:WBGene00007230 Length:1213 Species:Caenorhabditis elegans


Alignment Length:219 Identity:48/219 - (21%)
Similarity:72/219 - (32%) Gaps:84/219 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NFKSK--VKARPISYSLGTLHKHHTNFSTELENTINSESNFKNISNLIKFVRQHSKWYRDNDCIN 82
            :|:|.  .||.||   |..:.|...||:       |.||..:|.||.:            ::|  
 Worm   369 DFESSEVAKAGPI---LDVISKMSLNFA-------NYESIIQNASNKL------------SEC-- 409

  Fly    83 RHYFNYILLDPRVTNNLKERASQLHLMDVWYTFLRAIFYVGKGKATRPYVHLKNAQKLVDETN-N 146
              :.|:.:......|:        .|.::...|.:||     ..||....:|...:|.|...| |
 Worm   410 --FSNFSVTSLETPNS--------SLQEMIQDFQQAI-----SPATNYMKYLAQIRKQVSYININ 459

  Fly   147 ITLVKDP-------------KLALIVSIWKANRGVLLIRAFQGISSQDAQTREASIIDALG---- 194
            ..|...|             ||:..:...|.|:          .:|...:||...|||.:.    
 Worm   460 SILTIRPNRTIKSFFDEYYKKLSNEIEKQKVNK----------TNSLRVKTRLKIIIDQIDKREV 514

  Fly   195 -----MNHL----------TNRRL 203
                 |.||          ||:.|
 Worm   515 DFHNFMTHLSQNLKNIKVITNKSL 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105 12/63 (19%)
GIY-YIG_COG3680_Meta 85..200 CDD:198401 28/147 (19%)
C01G10.1NP_506722.2 WSN 23..91 CDD:197734
ANK <872..944 CDD:238125
ANK repeat 907..938 CDD:293786
BRCT 991..1063 CDD:214602
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.