Sequence 1: | NP_001137671.1 | Gene: | CG42391 / 7354405 | FlyBaseID: | FBgn0259737 | Length: | 253 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_506722.2 | Gene: | C01G10.1 / 180019 | WormBaseID: | WBGene00007230 | Length: | 1213 | Species: | Caenorhabditis elegans |
Alignment Length: | 219 | Identity: | 48/219 - (21%) |
---|---|---|---|
Similarity: | 72/219 - (32%) | Gaps: | 84/219 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 NFKSK--VKARPISYSLGTLHKHHTNFSTELENTINSESNFKNISNLIKFVRQHSKWYRDNDCIN 82
Fly 83 RHYFNYILLDPRVTNNLKERASQLHLMDVWYTFLRAIFYVGKGKATRPYVHLKNAQKLVDETN-N 146
Fly 147 ITLVKDP-------------KLALIVSIWKANRGVLLIRAFQGISSQDAQTREASIIDALG---- 194
Fly 195 -----MNHL----------TNRRL 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42391 | NP_001137671.1 | Peptidase_S80 | <37..>101 | CDD:305105 | 12/63 (19%) |
GIY-YIG_COG3680_Meta | 85..200 | CDD:198401 | 28/147 (19%) | ||
C01G10.1 | NP_506722.2 | WSN | 23..91 | CDD:197734 | |
ANK | <872..944 | CDD:238125 | |||
ANK repeat | 907..938 | CDD:293786 | |||
BRCT | 991..1063 | CDD:214602 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG4177 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |