DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and C18H2.5

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_741231.2 Gene:C18H2.5 / 176082 WormBaseID:WBGene00015992 Length:1195 Species:Caenorhabditis elegans


Alignment Length:214 Identity:50/214 - (23%)
Similarity:88/214 - (41%) Gaps:45/214 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 STELENTINSESNFKNISNLIKFVRQHSKWYRDN-------------DCINRHYFNYILLDPRVT 96
            |.:.|:....:.:.|.:|:|...:.:...|..:.             |.:|.  .|...|:|:.|
 Worm   411 SAQTEDFARFDEHSKTLSDLNSTIFEVLAWCNETVKQNDFDVMETALDSLNN--LNLENLNPQET 473

  Fly    97 -NNLKERASQLHLMDVWYTFLRAIFYVGKGKATRPY--VHLKNAQKLVDET-NNITLVKDPKLAL 157
             |.::|..:...|.|.:..|||  |::.:.|....|  :|..|...:::|| .|:|..|      
 Worm   474 INEVREIQNFEDLNDFFERFLR--FHLLQKKYDTDYQLLHKVNLVDVMEETAANLTKSK------ 530

  Fly   158 IVSIWKANRGVLLIRAFQGISSQDAQTREASIIDALGMNHLTN-RRLGFYYGRARSLSDKERKYL 221
              ||  ||...|.::.||  ||:...|.|          .:|: ||:| .....:.:.|..:.|.
 Worm   531 --SI--ANLKCLKMKEFQ--SSKIHSTVE----------FITSVRRIG-NSSDHKKIKDAVKIYS 578

  Fly   222 GIALLYKLMMKFLAKEEKE 240
            .:...|..:.|||.:..::
 Worm   579 DMRTDYVAVEKFLEETRRQ 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105 13/69 (19%)
GIY-YIG_COG3680_Meta 85..200 CDD:198401 32/118 (27%)
C18H2.5NP_741231.2 WSN 40..108 CDD:197734
Ank_4 856..909 CDD:290365
ANK 860..>924 CDD:238125
ANK repeat 860..886 CDD:293786
ANK repeat 888..922 CDD:293786
BRCT 964..1044 CDD:214602
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.