DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42391 and ASB7

DIOPT Version :9

Sequence 1:	NP_001137671.1	Gene:	CG42391 / 7354405	FlyBaseID:	FBgn0259737	Length:	253	Species:	Drosophila melanogaster
Sequence 2:	NP_937886.1	Gene:	ASB7 / 140460	HGNCID:	17182	Length:	318	Species:	Homo sapiens

Alignment Length:	53	Identity:	13/53 - (24%)
Similarity:	21/53 - (39%)	Gaps:	13/53 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly   187 ASIIDALGMNHLTNRRLGFYYGR-------------ARSLSDKERKYLGIALL 226
            :.||:|...:..|...:..:|||             ...||||....|.:|::
Human   107 SDIINAKSNDGWTPLHVAAHYGRDSFVRLLLEFKAEVDPLSDKGTTPLQLAII 159

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42391	NP_001137671.1	Peptidase_S80	<37..>101	CDD:305105
CG42391	NP_001137671.1	GIY-YIG_COG3680_Meta	85..200	CDD:198401	3/12 (25%)
ASB7	NP_937886.1	ANK 1	13..42
		PHA02875	21..>241	CDD:165206	13/53 (25%)
		ANK repeat	46..77	CDD:293786
		ANK 2	46..75
		ANK 3	80..109		0/1 (0%)
		ANK repeat	81..114	CDD:293786	3/6 (50%)
		ANK repeat	116..147	CDD:293786	4/30 (13%)
		ANK 4	116..145		4/28 (14%)
		ANK repeat	149..180	CDD:293786	3/11 (27%)
		ANK 5	149..178		3/11 (27%)
		ANK 6	180..208
		ANK repeat	213..244	CDD:293786
		ANK 7	213..242
		SOCS_ASB7	273..317	CDD:239696
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG4177
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900