DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and F44E5.15

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001254314.1 Gene:F44E5.15 / 13187261 WormBaseID:WBGene00206377 Length:222 Species:Caenorhabditis elegans


Alignment Length:169 Identity:54/169 - (31%)
Similarity:83/169 - (49%) Gaps:23/169 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 YILLDPRVTNNLKERASQLHLMDVWY-TFLRAIFYVGKGKATRPYVHLKNAQKLVDETNNITLVK 151
            |:||.|.:          |.|.||.: .|:..|||||||...|...|...|   :.:.|:..:  
 Worm    64 YLLLHPTL----------LGLEDVKFDNFVSYIFYVGKGTGFRSLHHFIEA---LQKENDPYI-- 113

  Fly   152 DPKLALIVSIWKANRGVLLIRAFQGISSQDAQTREASIIDALGMNHLTNRRLGFYYGRARSLSDK 216
            |.|...|||||.:.:.:..::.|.|:||..||.:||::|.||..:.|||:..|.:.|.:...::|
 Worm   114 DSKCGSIVSIWNSGQEIGCVKIFVGVSSTVAQIKEAAMIKALSKHDLTNKIEGSFLGLSNIWNNK 178

  Fly   217 ERKYLG---IALLYKLM----MKFLAKEEKELFPLKNTK 248
            ::...|   |...|..|    :|.::|...|||....|:
 Worm   179 DKCQYGSFCIRKAYDQMKKDDIKRVSKSMVELFKDPETR 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105 4/12 (33%)
GIY-YIG_COG3680_Meta 85..200 CDD:198401 39/112 (35%)
F44E5.15NP_001254314.1 GIY-YIG_COG3680_Meta <76..162 CDD:198401 33/90 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167561
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I4011
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1451150at2759
OrthoFinder 1 1.000 - - FOG0005201
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3306
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.