DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and ANKLE1

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_689576.6 Gene:ANKLE1 / 126549 HGNCID:26812 Length:615 Species:Homo sapiens


Alignment Length:158 Identity:65/158 - (41%)
Similarity:92/158 - (58%) Gaps:0/158 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 FNYILLDPRVTNNLKERASQLHLMDVWYTFLRAIFYVGKGKATRPYVHLKNAQKLVDETNNITLV 150
            |.|:|||||.|.:|..||..|...:...||:|||||||||...||||||..|......:......
Human   451 FTYLLLDPRETQDLPARAFSLTPAERLQTFIRAIFYVGKGTRARPYVHLWEALGHHGRSRKQPHQ 515

  Fly   151 KDPKLALIVSIWKANRGVLLIRAFQGISSQDAQTREASIIDALGMNHLTNRRLGFYYGRARSLSD 215
            ..||:..|:.||.:..||:.:..||.:.:.:|.||||.|::|||:..|||::.|..||.......
Human   516 ACPKVRQILDIWASGCGVVSLHCFQHVVAVEAYTREACIVEALGIQTLTNQKQGHCYGVVAGWPP 580

  Fly   216 KERKYLGIALLYKLMMKFLAKEEKELFP 243
            ..|:.||:.||::.::.|||:.|::|.|
Human   581 ARRRRLGVHLLHRALLVFLAEGERQLHP 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105 9/14 (64%)
GIY-YIG_COG3680_Meta 85..200 CDD:198401 49/113 (43%)
ANKLE1NP_689576.6 ANK 23..128 CDD:238125
ANK 1 39..71
ANK repeat 75..106 CDD:293786
ANK 2 75..104
ANK 3 108..137
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 138..210
Nuclear export signal. /evidence=ECO:0000269|PubMed:27245214 271..280
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..315
LEM_ANKL1 361..398 CDD:240590
GIY-YIG_COG3680_Meta 450..565 CDD:198401 49/113 (43%)
Nuclear localization signal. /evidence=ECO:0000269|PubMed:27245214 579..586 1/6 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1451150at2759
OrthoFinder 1 1.000 - - FOG0005201
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3306
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.