DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42391 and Ank3

DIOPT Version :9

Sequence 1:	NP_001137671.1	Gene:	CG42391 / 7354405	FlyBaseID:	FBgn0259737	Length:	253	Species:	Drosophila melanogaster
Sequence 2:	XP_036011414.1	Gene:	Ank3 / 11735	MGIID:	88026	Length:	4691	Species:	Mus musculus

Alignment Length:	72	Identity:	17/72 - (23%)
Similarity:	31/72 - (43%)	Gaps:	0/72 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   123 GKGKATRPYVHLKNAQKLVDETNNITLVKDPKLALIVSIWKANRGVLLIRAFQGISSQDAQTREA 187
            |.|:...|...|...||.::||:.:.:...||..:.|.:.|..|.....:|...:..::..||..
Mouse  4511 GCGRTEEPVSPLTAYQKSLEETSKLVIEDAPKPCVPVGMKKMTRTTADGKARLNLQEEEGSTRSE 4575

  Fly   188 SIIDALG 194
            ..:.:.|
Mouse  4576 PKVKSPG 4582

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42391	NP_001137671.1	Peptidase_S80	<37..>101	CDD:305105
CG42391	NP_001137671.1	GIY-YIG_COG3680_Meta	85..200	CDD:198401	17/72 (24%)
Ank3	XP_036011414.1	Ank_2	59..>304	CDD:423045
		ANK repeat	73..104	CDD:293786
		ANK repeat	106..137	CDD:293786
		ANK repeat	139..164	CDD:293786
		Ank_2	195..>437	CDD:423045
		ANK repeat	205..240	CDD:293786
		ANK repeat	242..273	CDD:293786
		ANK repeat	275..306	CDD:293786
		ANK repeat	308..333	CDD:293786
		ANK repeat	341..372	CDD:293786
		PHA03095	377..>665	CDD:222980
		ANK repeat	377..405	CDD:293786
		ANK repeat	407..438	CDD:293786
		ANK repeat	440..471	CDD:293786
		ANK repeat	473..504	CDD:293786
		ANK repeat	506..537	CDD:293786
		ANK repeat	539..568	CDD:293786
		Ank_2	559..>796	CDD:423045
		ANK repeat	572..601	CDD:293786
		ANK repeat	605..634	CDD:293786
		ANK repeat	638..669	CDD:293786
		ANK repeat	671..702	CDD:293786
		ANK repeat	704..735	CDD:293786
		ANK repeat	737..768	CDD:293786
		ANK repeat	770..798	CDD:293786
		Ank_4	771..823	CDD:372654
		ZU5	1018..1155	CDD:128514
		UPA_2	1377..1506	CDD:375346
		Herpes_BLLF1	<1542..1949	CDD:282904
		DUF2890	3296..>3412	CDD:314108
		Death_ank3	4113..4196	CDD:176781
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG4177
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900