DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42391 and Ank1

DIOPT Version :9

Sequence 1:	NP_001137671.1	Gene:	CG42391 / 7354405	FlyBaseID:	FBgn0259737	Length:	253	Species:	Drosophila melanogaster
Sequence 2:	XP_006509052.1	Gene:	Ank1 / 11733	MGIID:	88024	Length:	1950	Species:	Mus musculus

Alignment Length:	105	Identity:	26/105 - (24%)
Similarity:	40/105 - (38%)	Gaps:	21/105 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly    56 SNFKNISNLIKFVRQHSKWYRDNDCINRHYFNYILLDPR--------VTNNLKERASQLHLMDVW 112
            |::.|| .|:||:.||..     |...:....|..|...        ||..||..||...:....
Mouse   760 SHYGNI-KLVKFLLQHQA-----DVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNG 818

  Fly   113 YTFLRAIFYVGKGKATRPYVHLKNAQKLVDETNNITLVKD 152
            .|.|.....:|       |:.:.:..|:|.:..::.||.|
Mouse   819 TTPLAIAKRLG-------YISVTDVLKVVTDETSVVLVSD 851

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42391	NP_001137671.1	Peptidase_S80	<37..>101	CDD:305105	14/52 (27%)
CG42391	NP_001137671.1	GIY-YIG_COG3680_Meta	85..200	CDD:198401	17/76 (22%)
Ank1	XP_006509052.1	ANK repeat	454..485	CDD:293786
		ANK repeat	487..518	CDD:293786
		ANK repeat	520..549	CDD:293786
		ANK repeat	554..584	CDD:293786
		ANK repeat	586..617	CDD:293786
		Ank_2	597..>810	CDD:393464	15/55 (27%)
		ANK repeat	619..647	CDD:293786
		ANK repeat	652..682	CDD:293786
		ANK repeat	685..716	CDD:293786
		ANK repeat	718..749	CDD:293786
		ANK repeat	751..782	CDD:293786	9/27 (33%)
		ANK repeat	784..812	CDD:293786	8/27 (30%)
		Ank_4	785..837	CDD:372654	12/58 (21%)
		ZU5	970..1074	CDD:128514
		UPA_2	1295..1424	CDD:375346
		Death_ank1	1460..1543	CDD:260067
		ANK repeat	65..93	CDD:293786
		Ank_2	67..158	CDD:372319
		ANK repeat	95..126	CDD:293786
		ANK repeat	129..159	CDD:293786
		PHA02876	<141..>486	CDD:165207
		ANK repeat	161..192	CDD:293786
		ANK repeat	194..218	CDD:293786
		ANK repeat	227..254	CDD:293786
		ANK repeat	257..287	CDD:293786
		ANK repeat	289..320	CDD:293786
		ANK repeat	322..353	CDD:293786
		ANK repeat	355..386	CDD:293786
		ANK repeat	391..419	CDD:293786
		ANK repeat	421..452	CDD:293786
		PHA02875	433..>643	CDD:165206
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG4177
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900