DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42391 and ank3a

DIOPT Version :9

Sequence 1:	NP_001137671.1	Gene:	CG42391 / 7354405	FlyBaseID:	FBgn0259737	Length:	253	Species:	Drosophila melanogaster
Sequence 2:	XP_009291264.1	Gene:	ank3a / 103909035	ZFINID:	ZDB-GENE-060621-1	Length:	4499	Species:	Danio rerio

Alignment Length:	62	Identity:	15/62 - (24%)
Similarity:	31/62 - (50%)	Gaps:	8/62 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly    30 ISYSLGTLHKHHTNFSTELENTINSESNFKNISNLIKFVRQHSKWYR-------DNDCINRH 84
            :.:|:|.......:||::..||:| .|:|...|.:|:.:...:|...       :|:|:.|:
Zfish   904 MGFSIGARSASLRSFSSDRSNTLN-RSSFARDSMMIEEILAPTKDTHLAVTREYNNECMRRY 964

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42391	NP_001137671.1	Peptidase_S80	<37..>101	CDD:305105	13/55 (24%)
CG42391	NP_001137671.1	GIY-YIG_COG3680_Meta	85..200	CDD:198401	15/62 (24%)
ank3a	XP_009291264.1	Ank_4	48..95	CDD:290365
		ANK	69..194	CDD:238125
		ANK repeat	74..105	CDD:293786
		Ank_2	79..169	CDD:289560
		ANK repeat	107..138	CDD:293786
		ANK repeat	140..169	CDD:293786
		Ank_2	145..271	CDD:289560
		ANK repeat	206..241	CDD:293786
		ANK	238..363	CDD:238125
		ANK repeat	243..274	CDD:293786
		Ank_2	248..339	CDD:289560
		ANK repeat	276..307	CDD:293786
		ANK repeat	309..340	CDD:293786
		ANK	338..461	CDD:238125
		ANK repeat	342..373	CDD:293786
		Ank_2	347..438	CDD:289560
		ANK repeat	375..406	CDD:293786
		ANK	403..528	CDD:238125
		ANK repeat	408..439	CDD:293786
		Ank_2	413..504	CDD:289560
		ANK repeat	441..472	CDD:293786
		ANK	469..594	CDD:238125
		ANK repeat	474..505	CDD:293786
		Ank_2	479..569	CDD:289560
		ANK repeat	507..536	CDD:293786
		ANK repeat	540..569	CDD:293786
		Ank_2	545..634	CDD:289560
		ANK	569..693	CDD:238125
		ANK repeat	573..602	CDD:293786
		ANK repeat	606..634	CDD:293786
		ANK repeat	639..670	CDD:293786
		Ank_4	640..693	CDD:290365
		ANK	667..792	CDD:238125
		ANK repeat	675..703	CDD:293786
		Ank_2	677..768	CDD:289560
		ANK repeat	705..736	CDD:293786
		ANK repeat	738..769	CDD:293786
		Ank_5	758..812	CDD:290568
		ANK repeat	771..799	CDD:293786
		ZU5	995..1099	CDD:128514
		Death_ank3	3886..3969	CDD:176781
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG4177
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900