DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42391 and Ankdd1a

DIOPT Version :9

Sequence 1:NP_001137671.1 Gene:CG42391 / 7354405 FlyBaseID:FBgn0259737 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_006243362.1 Gene:Ankdd1a / 100362785 RGDID:1586052 Length:509 Species:Rattus norvegicus


Alignment Length:119 Identity:29/119 - (24%)
Similarity:49/119 - (41%) Gaps:32/119 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 WKANRGVLLIRAFQGISSQDAQTREASIIDALGMNHLT--------NRRLGFY-----YGRARSL 213
            |:....:||| |...:|.:|.|.:.|..: |...||::        :|   ||     :...|..
  Rat   326 WQDVAEMLLI-AGADLSLRDKQGKTALAV-AARSNHISLVDMIIKADR---FYRWEKDHLSCRDD 385

  Fly   214 SDKERKYLGI------------ALLYKLMMKFLAKEE--KELFPLKNTKAAMAA 253
            ||..||.|..            ::|::|..::|...|  |..:..:.|:|.:.|
  Rat   386 SDLSRKNLTFKQDHRQETQQLRSVLWRLASRYLRPNEWKKLAYSWQFTEAHVCA 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42391NP_001137671.1 Peptidase_S80 <37..>101 CDD:305105
GIY-YIG_COG3680_Meta 85..200 CDD:198401 12/45 (27%)
Ankdd1aXP_006243362.1 Ank_2 19..108 CDD:289560
ANK repeat 19..45 CDD:293786
ANK 43..169 CDD:238125
ANK repeat 47..78 CDD:293786
ANK repeat 80..110 CDD:293786
ANK 112..235 CDD:238125
ANK repeat 113..146 CDD:293786
Ank_4 114..169 CDD:290365
ANK repeat 149..179 CDD:293786
Ank_2 153..243 CDD:289560
ANK 178..301 CDD:238125
ANK repeat 181..212 CDD:293786
ANK repeat 214..245 CDD:293786
ANK 242..367 CDD:238125 12/42 (29%)
ANK repeat 247..278 CDD:293786
Ank_2 252..344 CDD:289560 6/18 (33%)
ANK repeat 280..311 CDD:293786
ANK repeat 313..344 CDD:293786 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.