DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yeti and SWC5

DIOPT Version :9

Sequence 1:NP_001137537.1 Gene:Yeti / 7354404 FlyBaseID:FBgn0267398 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_009790.3 Gene:SWC5 / 852532 SGDID:S000000435 Length:303 Species:Saccharomyces cerevisiae


Alignment Length:290 Identity:69/290 - (23%)
Similarity:111/290 - (38%) Gaps:91/290 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ETDDDYYVDLLTSGKGSDKSESDVSDKSENYPGLKSKHTAK-------------ALRKTRHCDGD 63
            |.|:|:..:....|.|||  :||.||..::|....::...:             .|.|||.....
Yeast    24 EEDEDFQPEKDKLGGGSD--DSDASDGGDDYDDGVNRDKGRNKVDYSRIESESGGLIKTRRARQA 86

  Fly    64 NREYRSKECDDLHSEE----ESEKSRSDALWADFLGDIDTKSVINQKTDYTEGNAASATNTNTHE 124
            ..||..     .|..|    ||..::.:::|.: |.:.....:::     :.|...|..:.    
Yeast    87 EEEYAK-----THKYESLTVESIPAKVNSIWEE-LQEASKNRLLS-----SSGKVGSVLDG---- 136

  Fly   125 TCNKYDKNDTAIIKTAQQYDSKRTTLSVSTLGK-------IKRSSA------------------- 163
              :|..::.||    |||.|......:....|:       :.||||                   
Yeast   137 --SKEARSTTA----AQQEDKILIERNYKFAGETVHEKKWVSRSSAEGQEYLNSLKFKQQAPAAP 195

  Fly   164 ---EKSIGTMINKFEK--------------------KKKLTVLERSQLDWKIFKQDEGIDELLCS 205
               ||::.|..|:..:                    :.|||.||:|||||..:....|:::.|..
Yeast   196 VQLEKAVRTKSNESRQHLRRPLKRPPLLEQIISGGLRPKLTTLEKSQLDWASYVDRAGLNDELVL 260

  Fly   206 HNKGKDGYLDRQDFLERTDLRQFEMEKKLR 235
            ||  |||:|.||:||:|....:.|..|:||
Yeast   261 HN--KDGFLARQEFLQRVGSAEDERYKELR 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YetiNP_001137537.1 BCNT 165..237 CDD:284897 30/91 (33%)
SWC5NP_009790.3 BCNT 233..286 CDD:400111 24/54 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I2850
eggNOG 1 0.900 - - E1_KOG4776
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005155
OrthoInspector 1 1.000 - - oto100252
orthoMCL 1 0.900 - - OOG6_104154
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2303
SonicParanoid 1 1.000 - - X4189
TreeFam 00.000 Not matched by this tool.
98.740

Return to query results.
Submit another query.