DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yeti and AT5G30490

DIOPT Version :9

Sequence 1:NP_001137537.1 Gene:Yeti / 7354404 FlyBaseID:FBgn0267398 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001078630.1 Gene:AT5G30490 / 833136 AraportID:AT5G30490 Length:236 Species:Arabidopsis thaliana


Alignment Length:182 Identity:51/182 - (28%)
Similarity:91/182 - (50%) Gaps:28/182 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 KSRSDALWADFLG-----------DIDTKSVINQK-TDYTEGNAASA-----TNTNTHETCNKYD 130
            |:.:::.|..:||           |:. |||:|.. ::..:..||:|     ..|.|....:...
plant    46 KNSANSNWKSYLGVNVKKKDTCVSDVQ-KSVLNHSCSEEAKSIAAAALAAVRNATVTAAAASSRG 109

  Fly   131 KNDTAIIK--TAQQYDSKR-------TTLSVSTLGKIKRSSAEKSIGTMINKFEKKKKLTVLERS 186
            |.:...:|  ..|:.:.||       ..|.....|....|:|..::..::.:.:||:||:||:::
plant   110 KIEITEVKDFAGQEIEVKRLVEADSKEALERGNKGSSSSSAAPSAVDAVLEQIKKKQKLSVLDKT 174

  Fly   187 QLDWKIFKQD-EGIDELLCSHNKGKDGYLDRQDFLERTDLRQFEMEKKLRLS 237
            :.||..:|:: :|:::.|..:.|..|.|||:..||||.|.||||.|:..||:
plant   175 KKDWGEYKEEHKGVEDELDKYKKSSDQYLDKVGFLERADYRQFEKERDARLA 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YetiNP_001137537.1 BCNT 165..237 CDD:284897 27/72 (38%)
AT5G30490NP_001078630.1 BCNT 156..226 CDD:400111 27/69 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 63 1.000 Domainoid score I3724
eggNOG 1 0.900 - - E1_KOG4776
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1372508at2759
OrthoFinder 1 1.000 - - FOG0005155
OrthoInspector 1 1.000 - - oto3761
orthoMCL 1 0.900 - - OOG6_104154
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4189
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.720

Return to query results.
Submit another query.