DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yeti and cfdp1

DIOPT Version :9

Sequence 1:NP_001137537.1 Gene:Yeti / 7354404 FlyBaseID:FBgn0267398 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001093505.1 Gene:cfdp1 / 567870 ZFINID:ZDB-GENE-030131-5736 Length:312 Species:Danio rerio


Alignment Length:291 Identity:84/291 - (28%)
Similarity:137/291 - (47%) Gaps:62/291 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NSQKEYVSDC--------ETDDDYYVDLLTSGKGSDKSESDVSDKSENYPGLKSKHTAKALRKTR 58
            |..::.::||        |..|....:.||  |...||::||..:.....|||.....:|....:
Zfish    25 NLSEDDINDCVKEDALEGEDHDRQTPENLT--KKKKKSKADVHMRKRKKGGLKLVEDGEASTADQ 87

  Fly    59 HCDGD---NREYRSKECDDLHSEEESEKSRSDALWADFLGDI-----DTKSVINQKTDYTEGNAA 115
            ..|.|   ..::.:|...|:   ||.:|.::|.|||.||.||     :..|..:||  :|...|.
Zfish    88 QKDEDEPKEDDFVTKSVGDI---EERQKKKADDLWASFLSDIPRPKAEVPSASSQK--FTSAAAT 147

  Fly   116 SATNTNTHETCNKYDK-NDTAIIKTAQQYD----SKRTTLSVSTLGKIKR--------------- 160
            ...:..:..:..|.|| .|::.|...:.:|    ..|.|..|....:..:               
Zfish   148 DEPSKLSTASSQKEDKPKDSSKITITKVFDFAGEEVRVTKEVDARSREAKSFLKNEEKLLEDTKE 212

  Fly   161 ----------------SSAEK--SIGTMINKF-EKKKKLTVLERSQLDWKIFKQDEGIDELLCSH 206
                            |||::  .:|:::|:. .||:|::.||:|::||..||.:|||.:.|..|
Zfish   213 PSVSSEPQPPHPLSSGSSAKRPAGMGSILNRIGAKKQKMSTLEKSKMDWDAFKSEEGITDELAIH 277

  Fly   207 NKGKDGYLDRQDFLERTDLRQFEMEKKLRLS 237
            |:||:||::|::||||.|.||||:||.:||:
Zfish   278 NRGKEGYVERKNFLERVDQRQFELEKTVRLN 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YetiNP_001137537.1 BCNT 165..237 CDD:284897 35/74 (47%)
cfdp1NP_001093505.1 BCNT 235..307 CDD:284897 34/71 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I8319
eggNOG 1 0.900 - - E1_KOG4776
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I5011
OMA 1 1.010 - - QHG48717
OrthoDB 1 1.010 - - D1372508at2759
OrthoFinder 1 1.000 - - FOG0005155
OrthoInspector 1 1.000 - - oto40562
orthoMCL 1 0.900 - - OOG6_104154
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2303
SonicParanoid 1 1.000 - - X4189
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.810

Return to query results.
Submit another query.