DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yeti and Cfdp1

DIOPT Version :9

Sequence 1:NP_001137537.1 Gene:Yeti / 7354404 FlyBaseID:FBgn0267398 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_955410.1 Gene:Cfdp1 / 292027 RGDID:735080 Length:295 Species:Rattus norvegicus


Alignment Length:303 Identity:87/303 - (28%)
Similarity:135/303 - (44%) Gaps:87/303 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EYVSDCETDDDYYVDLLTSGKGSDKSESDVSD---------------------KSENYPGLKSKH 49
            |..|..:.|:||.      ..|.:.||.||::                     |:::.|..|.|.
  Rat     7 EDFSTSDEDEDYV------PSGGEYSEDDVNELVKEDEVDGEEQAEKTKGKRRKAQSIPARKRKQ 65

  Fly    50 TAKALRKTRHCD----GDNREYRSKECDDLHSEEESEKSRSDALWADFLGDIDTKSVINQKTDYT 110
            :...|.:....:    |.:||...:|.:.....|.|.|.:.|.|||.||.|:.|||         
  Rat    66 SGLLLDEEEDGEEDSGGSSREEDEEEQEGGLGSETSRKKKEDELWASFLNDVGTKS--------- 121

  Fly   111 EGNAASATNT----NTHETCN-----KYDK----NDTAIIKTAQQYD----SKRTTLSVSTLGK- 157
              .|||::..    .|.||.:     |.|:    .::..:|..:.:|    ..|.|..|....| 
  Rat   122 --KAASSSQVKVAEETEETSSSKPLVKADELEKPKESEKVKITKVFDFAGEEVRVTKEVDATSKE 184

  Fly   158 ----IKRSSAEK----------------------SIGTMINKF-EKKKKLTVLERSQLDWKIFKQ 195
                :|::..||                      .:.:::.|. .||:|::.||:|:|||:.||:
  Rat   185 AKSFLKQTEKEKPQALVTSAATPPPAGSGIKRTSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKE 249

  Fly   196 DEGIDELLCSHNKGKDGYLDRQDFLERTDLRQFEMEKKLRLSR 238
            :|||.|.|..||:||:||::|:.||||.|.||||:|:.||||:
  Rat   250 EEGIGEELAIHNRGKEGYIERKAFLERVDHRQFEIERDLRLSK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YetiNP_001137537.1 BCNT 165..237 CDD:284897 37/94 (39%)
Cfdp1NP_955410.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..155 40/164 (24%)
Hydrophilic 174..213 6/38 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..219 3/30 (10%)
BCNT 218..291 CDD:284897 36/72 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I8272
eggNOG 1 0.900 - - E1_KOG4776
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I4879
OMA 1 1.010 - - QHG48717
OrthoDB 1 1.010 - - D1372508at2759
OrthoFinder 1 1.000 - - FOG0005155
OrthoInspector 1 1.000 - - oto98560
orthoMCL 1 0.900 - - OOG6_104154
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4189
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.780

Return to query results.
Submit another query.