DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17454 and AT2G02570

DIOPT Version :9

Sequence 1:NP_001138001.1 Gene:CG17454 / 7354399 FlyBaseID:FBgn0039977 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001077871.1 Gene:AT2G02570 / 814787 AraportID:AT2G02570 Length:300 Species:Arabidopsis thaliana


Alignment Length:295 Identity:80/295 - (27%)
Similarity:124/295 - (42%) Gaps:76/295 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADDLHNYKLQLQQVEAALQTDPENEELLKLRSDLDEVITLTRDLIQTQLEEQNKSSYVEPSSTK 65
            :|..:..||.||:||...|..||.|.|...:..:|.|||.||.:::.|  .:||:.| :..:...
plant    13 LASSISTYKEQLEQVRQLLSEDPRNSEYADMEKELKEVIALTEEVLAT--AKQNEIS-LSDAGVS 74

  Fly    66 RDSSNYFDEIEAALLEAEKLVSAAKIWKK---------------GDKCQAKWKEDRQYYDATIED 115
            .:::....::|.|             |:|               |.|.||.:.:|.::||||||.
plant    75 AEATPGSPDLEGA-------------WEKTGLRNDPIHEGKFPVGTKVQAVFSDDGEWYDATIEA 126

  Fly   116 ISSTG----------------------EVNVIFDAYQNRSTTHVNELRER-------TIRNEVFP 151
            .::.|                      |.|.|.:|.:....|. |.|:.:       ..:.:..|
plant   127 HTANGYFVAYDEWGNKEEVDPDNVRPIEQNAIVEAERLAQATK-NALKRKIEKAASSDYQTKTLP 190

  Fly   152 SNKRHRPNQKEYLKKRKQKK------QQRFKDLEEERESDKNKWLNFNNKNQKK------NGMKA 204
            :..:..||..|.:|..|:||      :.||:.||..:...:|.|..|.....|.      .|.|.
plant   191 AKLKIDPNDPEDVKIAKRKKIHAFKSKARFEQLEVVQNKKQNDWQQFQTTKAKTKKVGFFTGRKK 255

  Fly   205 RSIFASPDNVSGRVGVGTCGTAGKGMTDFTVGEKY 239
            .|||.||::..|:|||   ..:|||:|||...||:
plant   256 ESIFKSPEDPFGKVGV---TGSGKGLTDFQKREKH 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17454NP_001138001.1 TroA-like <22..>116 CDD:294188 29/108 (27%)
TUDOR 95..142 CDD:119391 19/68 (28%)
AT2G02570NP_001077871.1 TUDOR 101..155 CDD:197660 12/53 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3026
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I2327
OMA 1 1.010 - - QHG54699
OrthoDB 1 1.010 - - D1459016at2759
OrthoFinder 1 1.000 - - FOG0005574
OrthoInspector 1 1.000 - - oto4197
orthoMCL 1 0.900 - - OOG6_103070
Panther 1 1.100 - - LDO PTHR13681
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3989
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.840

Return to query results.
Submit another query.