DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17454 and Smn1

DIOPT Version :9

Sequence 1:NP_001138001.1 Gene:CG17454 / 7354399 FlyBaseID:FBgn0039977 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_071954.2 Gene:Smn1 / 64301 RGDID:620755 Length:288 Species:Rattus norvegicus


Alignment Length:107 Identity:31/107 - (28%)
Similarity:48/107 - (44%) Gaps:9/107 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 KIWKKGDKCQAKWKEDRQYYDATIEDISSTGEV-NVIFDAYQNRSTTHVNELRERTIRNEVFPSN 153
            |.||.||||.|.|.||...|.|||..:....|. .|::..|.|:...::::|...|.  ||  :|
  Rat    87 KQWKAGDKCSAVWSEDGCVYPATITSVDLKRETCVVVYTGYGNKEEQNLSDLLSPTC--EV--AN 147

  Fly   154 KRHRPNQKEYLKKRKQKKQQRFKDLEEERESDKNK---WLNF 192
            ...:..|:...:......:...:.|..:..| |:|   |.:|
  Rat   148 NTEQNTQENESQVSTDDSEHSSRSLRSKAHS-KSKAAPWTSF 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17454NP_001138001.1 TroA-like <22..>116 CDD:294188 15/25 (60%)
TUDOR 95..142 CDD:119391 17/47 (36%)
Smn1NP_071954.2 P1 (binding site for GEMIN2). /evidence=ECO:0000250 10..41
SMN 24..280 CDD:399180 31/107 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 54..87 31/107 (29%)
Required for interaction with RPP20/POP7. /evidence=ECO:0000250 94..204 26/100 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..225 7/41 (17%)
P2 (binding site for SM B). /evidence=ECO:0000250 234..261
Required for interaction with SYNCRIP. /evidence=ECO:0000250 273..288
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539238at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.