DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17454 and Smn

DIOPT Version :9

Sequence 1:NP_001138001.1 Gene:CG17454 / 7354399 FlyBaseID:FBgn0039977 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001261954.1 Gene:Smn / 39844 FlyBaseID:FBgn0036641 Length:226 Species:Drosophila melanogaster


Alignment Length:165 Identity:35/165 - (21%)
Similarity:59/165 - (35%) Gaps:38/165 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 DEVITLTRDLIQTQLEEQNKSSYVEPSSTKRDSSNYFDEIEAALLEAEKLVSAAKI--------- 91
            ||.:.|.|:.:..:|               .||:|..:|..||..|.|    |.:|         
  Fly    20 DESVGLAREALARRL---------------ADSTNKREEENAAAAEEE----AGEISATGGATSP 65

  Fly    92 ----WKKGDKCQAKWKEDRQYYDATIEDISSTGEVNVIFDAYQNRSTTHVNELRE---RTIRNEV 149
                :|.||..:|.:.:...|..|.:......|...:.:..|:|.....:.:|..   :.:|.|.
  Fly    66 EPVSFKVGDYARATYVDGVDYEGAVVSINEEKGTCVLRYLGYENEQEVLLVDLLPSWGKRVRREQ 130

  Fly   150 FPSNKRHRPNQKEYLKKRKQKKQQRFKDLEEERES 184
            |...|:   ::.|.|.:.|.......|..:..|.|
  Fly   131 FLIAKK---DEDEQLSRPKASAGSHSKTPKSSRRS 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17454NP_001138001.1 TroA-like <22..>116 CDD:294188 21/92 (23%)
TUDOR 95..142 CDD:119391 9/46 (20%)
SmnNP_001261954.1 SMN 2..215 CDD:283622 35/165 (21%)
TUDOR 68..122 CDD:295375 10/53 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458101
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539238at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13681
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.