DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17454 and Smn1

DIOPT Version :9

Sequence 1:NP_001138001.1 Gene:CG17454 / 7354399 FlyBaseID:FBgn0039977 Length:243 Species:Drosophila melanogaster
Sequence 2:XP_011242939.1 Gene:Smn1 / 20595 MGIID:109257 Length:293 Species:Mus musculus


Alignment Length:104 Identity:30/104 - (28%)
Similarity:45/104 - (43%) Gaps:3/104 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 KIWKKGDKCQAKWKEDRQYYDATIEDISSTGEV-NVIFDAYQNRSTTHVNELRERTIRNEVFPSN 153
            |.||.||||.|.|.||...|.|||..|....|. .|::..|.||...::::|...|.  ||..|.
Mouse    87 KQWKVGDKCSAVWSEDGCIYPATITSIDFKRETCVVVYTGYGNREEQNLSDLLSPTC--EVANST 149

  Fly   154 KRHRPNQKEYLKKRKQKKQQRFKDLEEERESDKNKWLNF 192
            :::....:..:.....:...|....:...:|....|.:|
Mouse   150 EQNTQENESQVSTDDSEHSSRSLRSKAHSKSKAAPWTSF 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17454NP_001138001.1 TroA-like <22..>116 CDD:294188 15/25 (60%)
TUDOR 95..142 CDD:119391 19/47 (40%)
Smn1XP_011242939.1 SMN 24..273 CDD:310529 30/104 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D539238at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.