DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17454 and smr-1

DIOPT Version :9

Sequence 1:NP_001138001.1 Gene:CG17454 / 7354399 FlyBaseID:FBgn0039977 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001022932.1 Gene:smr-1 / 175281 WormBaseID:WBGene00004891 Length:239 Species:Caenorhabditis elegans


Alignment Length:254 Identity:72/254 - (28%)
Similarity:115/254 - (45%) Gaps:56/254 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADDLHNYKLQLQQVEAALQTDPENEELLKLRSDLDEVITLTRDLIQTQLEEQNKSSYVEPSSTK 65
            |.::|.:||||||||||||..||.|.|||||:.||.|:|:|..||.:|...|.::.:.|.|....
 Worm     1 MEEELASYKLQLQQVEAALLGDPTNVELLKLKEDLGEIISLQEDLAETDKAESSERAVVAPQVIH 65

  Fly    66 RDSSNYFDEIEAALLEAEKLVSAAKIWKKGDKCQAKWKEDRQYYDATIEDISSTGEVNVIFDAYQ 130
            :                         |..|::..|...:.::.: |.|:.::..| |.:.|.:..
 Worm    66 K-------------------------WTVGERVIAPHPDGKKVF-ARIDSLTPAG-VAITFTSTG 103

  Fly   131 NRSTTHVNELR---ERTIRNEVF--------PS---NKRHRPNQKEYLKKRKQKKQQRFKDLEEE 181
            .::.....:|:   |...:|..|        ||   .|:....:||..:::..||||:.|:|:..
 Worm   104 TKTIVDPADLQLPPENQRKNYAFDNTKSAAGPSTQHGKKEWQAEKERRRQKALKKQQKQKELDSI 168

  Fly   182 RESDKNKWLNFNNKNQKK--NGMKARSIFASPDNVSGRVGVGTCGTAGKGMTDFTVGEK 238
            ::.:|..|..||.|...|  .|:|..|...|..:       |:..::|.|      |||
 Worm   169 KDGEKKSWQKFNTKANAKGLKGLKKVSATGSSQD-------GSASSSGGG------GEK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17454NP_001138001.1 TroA-like <22..>116 CDD:294188 24/93 (26%)
TUDOR 95..142 CDD:119391 8/49 (16%)
smr-1NP_001022932.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162790
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3774
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54699
OrthoDB 1 1.010 - - D1459016at2759
OrthoFinder 1 1.000 - - FOG0005574
OrthoInspector 1 1.000 - - oto18671
orthoMCL 1 0.900 - - OOG6_103070
Panther 1 1.100 - - LDO PTHR13681
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3989
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.