DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42375 and CMC2

DIOPT Version :9

Sequence 1:NP_001138048.1 Gene:CG42375 / 7354380 FlyBaseID:FBgn0259721 Length:80 Species:Drosophila melanogaster
Sequence 2:NP_031358.1 Gene:CMC2 / 852220 SGDID:S000007488 Length:109 Species:Saccharomyces cerevisiae


Alignment Length:81 Identity:23/81 - (28%)
Similarity:35/81 - (43%) Gaps:10/81 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHTDL-SSHLHTPACNKLIEELQACHENNAFAKFVGVCNSIDDKVVKCL-------KGERIARSA 57
            ||..| :...|  :|...|..|..||:...:.:..|:||:..|.:.|||       |...:..|.
Yeast     1 MHPQLEAERFH--SCLDFINALDKCHQKEYYKRIFGLCNNEKDALNKCLKEASLNNKKRAVIESR 63

  Fly    58 ANRAKARERQAKYKEK 73
            ..||...:|..|.:|:
Yeast    64 IKRADVEKRWKKIEEE 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42375NP_001138048.1 Cmc1 1..71 CDD:400756 22/77 (29%)
CMC2NP_031358.1 Cmc1 1..70 CDD:400756 20/70 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4148
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005820
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104914
Panther 1 1.100 - - LDO PTHR22977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.860

Return to query results.
Submit another query.