DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42375 and CMC2

DIOPT Version :9

Sequence 1:NP_001138048.1 Gene:CG42375 / 7354380 FlyBaseID:FBgn0259721 Length:80 Species:Drosophila melanogaster
Sequence 2:XP_016878950.1 Gene:CMC2 / 56942 HGNCID:24447 Length:205 Species:Homo sapiens


Alignment Length:100 Identity:37/100 - (37%)
Similarity:47/100 - (47%) Gaps:25/100 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHTDLSSHLHTPACNKLIEELQACHENNA-------------------FAKFVGVCNSIDDKVVK 46
            ||.|||.||||..||.||..|:.||:|..                   ..||.|.||.:|.::.|
Human   108 MHPDLSPHLHTEECNVLINLLKECHKNETCIISATYSVQKKSSGVYHNILKFFGYCNDVDRELRK 172

  Fly    47 CLKGERIARSAANRAKARERQAKYKEKLLQ--QES 79
            |||.|.:    .||.|:||.....::||..  :||
Human   173 CLKNEYV----ENRTKSREHGIAMRKKLFNPPEES 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42375NP_001138048.1 Cmc1 1..71 CDD:400756 33/88 (38%)
CMC2XP_016878950.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155226
Domainoid 1 1.000 69 1.000 Domainoid score I9668
eggNOG 1 0.900 - - E1_KOG4148
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5304
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45739
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005820
OrthoInspector 1 1.000 - - oto91679
orthoMCL 1 0.900 - - OOG6_104914
Panther 1 1.100 - - LDO PTHR22977
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5555
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.760

Return to query results.
Submit another query.