DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42375 and AT4G21192

DIOPT Version :9

Sequence 1:NP_001138048.1 Gene:CG42375 / 7354380 FlyBaseID:FBgn0259721 Length:80 Species:Drosophila melanogaster
Sequence 2:NP_001078417.1 Gene:AT4G21192 / 5008151 AraportID:AT4G21192 Length:80 Species:Arabidopsis thaliana


Alignment Length:71 Identity:23/71 - (32%)
Similarity:39/71 - (54%) Gaps:1/71 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHTDLSSHLHTPACNKLIEELQACHENNAFAKFVGVCNSIDDKVVKCLKGERIARSAANRAKARE 65
            ||..|:.|.| |.|.::|||.|.||.::...||.|.|..:..|:.:|.:.|:..:...|..::::
plant     1 MHPPLTPHRH-PMCLEIIEEFQKCHIDHPIGKFFGECTELKVKLDRCFRQEKAVKRKVNFEQSKK 64

  Fly    66 RQAKYK 71
            .|.:.|
plant    65 LQERLK 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42375NP_001138048.1 Cmc1 1..71 CDD:400756 22/69 (32%)
AT4G21192NP_001078417.1 Cmc1 1..70 CDD:400756 22/69 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I4399
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I2630
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005820
OrthoInspector 1 1.000 - - oto2873
orthoMCL 1 0.900 - - OOG6_104914
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5555
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.