powered by:
Protein Alignment CG42375 and AT4G21192
DIOPT Version :9
Sequence 1: | NP_001138048.1 |
Gene: | CG42375 / 7354380 |
FlyBaseID: | FBgn0259721 |
Length: | 80 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001078417.1 |
Gene: | AT4G21192 / 5008151 |
AraportID: | AT4G21192 |
Length: | 80 |
Species: | Arabidopsis thaliana |
Alignment Length: | 71 |
Identity: | 23/71 - (32%) |
Similarity: | 39/71 - (54%) |
Gaps: | 1/71 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MHTDLSSHLHTPACNKLIEELQACHENNAFAKFVGVCNSIDDKVVKCLKGERIARSAANRAKARE 65
||..|:.|.| |.|.::|||.|.||.::...||.|.|..:..|:.:|.:.|:..:...|..::::
plant 1 MHPPLTPHRH-PMCLEIIEEFQKCHIDHPIGKFFGECTELKVKLDRCFRQEKAVKRKVNFEQSKK 64
Fly 66 RQAKYK 71
.|.:.|
plant 65 LQERLK 70
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42375 | NP_001138048.1 |
Cmc1 |
1..71 |
CDD:400756 |
22/69 (32%) |
AT4G21192 | NP_001078417.1 |
Cmc1 |
1..70 |
CDD:400756 |
22/69 (32%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
50 |
1.000 |
Domainoid score |
I4399 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
50 |
1.000 |
Inparanoid score |
I2630 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0005820 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto2873 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_104914 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
1 |
1.000 |
- |
- |
|
X5555 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
8 | 7.860 |
|
Return to query results.
Submit another query.