DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42375 and cmc2

DIOPT Version :9

Sequence 1:NP_001138048.1 Gene:CG42375 / 7354380 FlyBaseID:FBgn0259721 Length:80 Species:Drosophila melanogaster
Sequence 2:NP_001002614.1 Gene:cmc2 / 368857 ZFINID:ZDB-GENE-030616-409 Length:78 Species:Danio rerio


Alignment Length:73 Identity:30/73 - (41%)
Similarity:44/73 - (60%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHTDLSSHLHTPACNKLIEELQACHENNAFAKFVGVCNSIDDKVVKCLKGERIARSAANRAKARE 65
            ||.|||.||||..||:||..|:.||:.:...||.|.||.:|..:.:||:.|...:...::|.|.|
Zfish     1 MHPDLSPHLHTDECNQLITLLKQCHKEHNVLKFFGTCNDMDRAMRECLRKEYQTKRERSKAHAEE 65

  Fly    66 RQAKYKEK 73
            .:.:.||:
Zfish    66 MRRRLKEQ 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42375NP_001138048.1 Cmc1 1..71 CDD:400756 28/69 (41%)
cmc2NP_001002614.1 Cmc1 1..71 CDD:285749 28/69 (41%)
Cx9C motif 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 14..24 5/9 (56%)
Cx9C motif 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 37..47 3/9 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..78 5/22 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590324
Domainoid 1 1.000 62 1.000 Domainoid score I10392
eggNOG 1 0.900 - - E1_KOG4148
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5356
OMA 1 1.010 - - QHG45739
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005820
OrthoInspector 1 1.000 - - oto41231
orthoMCL 1 0.900 - - OOG6_104914
Panther 1 1.100 - - LDO PTHR22977
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2462
SonicParanoid 1 1.000 - - X5555
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.