DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42375 and C35D10.17

DIOPT Version :9

Sequence 1:NP_001138048.1 Gene:CG42375 / 7354380 FlyBaseID:FBgn0259721 Length:80 Species:Drosophila melanogaster
Sequence 2:NP_001379778.1 Gene:C35D10.17 / 259504 WormBaseID:WBGene00016452 Length:102 Species:Caenorhabditis elegans


Alignment Length:79 Identity:32/79 - (40%)
Similarity:41/79 - (51%) Gaps:8/79 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHTDLSSHLHTPACNKLIEELQACHENNAFAKFVGVCNSIDDKVVKCLKGERIARSAANRAKARE 65
            |..|||.||||..||.|||.||.||......|.:|.|:..|:.|.:|.|.|||.|        |:
 Worm     1 MLPDLSPHLHTKECNMLIEFLQRCHSEKPIGKMIGKCSYWDEAVWQCTKKERIWR--------RD 57

  Fly    66 RQAKYKEKLLQQES 79
            ....||.::::..|
 Worm    58 NNPAYKRRIVELRS 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42375NP_001138048.1 Cmc1 1..71 CDD:400756 29/69 (42%)
C35D10.17NP_001379778.1 Cmc1 1..>56 CDD:400756 28/62 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163847
Domainoid 1 1.000 58 1.000 Domainoid score I7181
eggNOG 1 0.900 - - E1_KOG4148
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I4006
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005820
OrthoInspector 1 1.000 - - oto17770
orthoMCL 1 0.900 - - OOG6_104914
Panther 1 1.100 - - LDO PTHR22977
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2462
SonicParanoid 1 1.000 - - X5555
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.820

Return to query results.
Submit another query.