DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42375 and cmc1

DIOPT Version :9

Sequence 1:NP_001138048.1 Gene:CG42375 / 7354380 FlyBaseID:FBgn0259721 Length:80 Species:Drosophila melanogaster
Sequence 2:NP_596006.1 Gene:cmc1 / 2540486 PomBaseID:SPBC21D10.07 Length:104 Species:Schizosaccharomyces pombe


Alignment Length:91 Identity:28/91 - (30%)
Similarity:44/91 - (48%) Gaps:19/91 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 HTDLSSHLHTPACNKLIEELQACHENNAFAKFVGVCNSIDDKVVKCLKGERIARSAANRAKARER 66
            |.|:::.   ..|..||..|:.||:  :|.||.|.||:|..::..||..:|..::..||..||.|
pombe     4 HLDVNNQ---KQCADLIRALEECHK--SFGKFFGECNTIKYELKACLTKDRNDKARLNRENARMR 63

  Fly    67 QAKYKE--------------KLLQQE 78
            :...:|              ::||||
pombe    64 KKVIEENRKKEEIEERILTDRILQQE 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42375NP_001138048.1 Cmc1 1..71 CDD:400756 23/68 (34%)
cmc1NP_596006.1 Cmc1 1..68 CDD:285749 23/68 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4148
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2084
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005820
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104914
Panther 1 1.100 - - LDO PTHR22977
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.820

Return to query results.
Submit another query.