DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42375 and Cmc2

DIOPT Version :10

Sequence 1:NP_001138048.1 Gene:CG42375 / 7354380 FlyBaseID:FBgn0259721 Length:80 Species:Drosophila melanogaster
Sequence 2:NP_001389140.1 Gene:Cmc2 / 100363376 RGDID:2324599 Length:80 Species:Rattus norvegicus


Alignment Length:69 Identity:19/69 - (27%)
Similarity:30/69 - (43%) Gaps:22/69 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SSHLHTPACNKLIEELQACHENNAFAKFVGVCNSIDDKVVKCLKGERIARSAANRAKARERQAKY 70
            ::|||.                  ..||.|.||.:|.::.||||.|.:.:    |.::||..|..
  Rat    25 NTHLHN------------------ILKFFGHCNDLDREMRKCLKNEYMEK----RNRSREHGAAM 67

  Fly    71 KEKL 74
            :.:|
  Rat    68 RSRL 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42375NP_001138048.1 Cmc1 1..71 CDD:400756 18/64 (28%)
Cmc2NP_001389140.1 Cmc1 <29..71 CDD:400756 16/63 (25%)

Return to query results.
Submit another query.