DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42375 and Cmc2

DIOPT Version :9

Sequence 1:NP_001138048.1 Gene:CG42375 / 7354380 FlyBaseID:FBgn0259721 Length:80 Species:Drosophila melanogaster
Sequence 2:XP_002728664.1 Gene:Cmc2 / 100363376 RGDID:2324599 Length:80 Species:Rattus norvegicus


Alignment Length:69 Identity:19/69 - (27%)
Similarity:30/69 - (43%) Gaps:22/69 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SSHLHTPACNKLIEELQACHENNAFAKFVGVCNSIDDKVVKCLKGERIARSAANRAKARERQAKY 70
            ::|||.                  ..||.|.||.:|.::.||||.|.:.:    |.::||..|..
  Rat    25 NTHLHN------------------ILKFFGHCNDLDREMRKCLKNEYMEK----RNRSREHGAAM 67

  Fly    71 KEKL 74
            :.:|
  Rat    68 RSRL 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42375NP_001138048.1 Cmc1 1..71 CDD:400756 18/64 (28%)
Cmc2XP_002728664.1 Cmc1 <29..71 CDD:285749 16/63 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349105
Domainoid 1 1.000 65 1.000 Domainoid score I9817
eggNOG 1 0.900 - - E1_KOG4148
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5247
OMA 1 1.010 - - QHG45739
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005820
OrthoInspector 1 1.000 - - oto98747
orthoMCL 1 0.900 - - OOG6_104914
Panther 1 1.100 - - LDO PTHR22977
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5555
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.